(data stored in ACNUC7421 zone)

EMBL: CR954246.PRLC

CR954246.PRLC        Location/Qualifiers
FT   CDS_pept        375903..377954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSHAa0361"
FT                   /product="oligopeptidase A"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.24.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1325967, 8366062, 1537805; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85459"
FT                   /db_xref="GOA:Q3IIA7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA7"
FT                   /protein_id="CAI85459.1"
FT                   /translation="MTNANTNPLIGLEGLPPFSKIKPEHVVPALKHGIEQCRQAIEDVL
FT                   AKKSYTWNDLVLPLEEADDKLSRMFSPVSHLNSVMNNDELREQYEQCLPLISEYSTFVG
FT                   QHQGLFAAYNALYNSDEFKTLTTAQQKSITNALRDFKLSGIALEPAQQKRYGEISARLS
FT                   ELASKFGNNVMDATLAWHKHITDESELAGLPESALALAADTAKSKELDGWVFTLDFPSY
FT                   LPIMTYADNRELREETYTAFSTRASDQGPNAGEFDNSAIMSEELALRHELAQLLGFNSY
FT                   AEKSLATKMAETPAQVFSFLEDLAAKSKPQAEQELAELQAYAEQKHGITELAAWDFGYY
FT                   GEKLKQDKYAISDEVLRPYFPANKVLSGLFETVNRLFGISVKEVSDFDSYHKDVRFFEI
FT                   YDSSNTLRGRFYLDLYARDHKRGGAWMDDCMGRKVRASGELQTPVAYLVCNFNKAIGDK
FT                   PALFTHNEVTTLFHEFGHGIHHMLTQVDAAPVAGINGVAWDAVELPSQFLENWCYEEQA
FT                   LSFISGHYETGEPLPKELLDKLLAAKNYNSGMQMLRQLEFSLFDFKIHNDYVAGEPCNI
FT                   QAVLNDVRSRTSVIKAPEFNRFQHGFSHIFAGGYSAGYYSYKWAEVLSADAYSKFEEEG
FT                   IFNPETGRAFMQHILEKGGSEEPMELFKNFRGREPNVDALLRHSGIAA"
     atgaccaatg caaacactaa cccattaatt gggcttgaag gcttaccgcc attttcaaaa        60
     ataaagccag agcacgtagt gccagcacta aagcacggga ttgagcagtg ccgccaagcc       120
     attgaagatg tgcttgctaa aaaatcatac acttggaacg atttagtact gccactagaa       180
     gaagccgatg ataaattatc acggatgttt tcgccggtat cgcatttaaa ttcggtaatg       240
     aataacgacg aactacgtga gcaatacgag caatgtttac cacttatttc tgagtactca       300
     acttttgtag ggcagcatca aggtttgttt gcagcttaca acgcgttata taacagtgat       360
     gaatttaaaa ccctcactac cgctcagcaa aagtcgatta ctaatgcatt acgcgatttt       420
     aaattatcgg gtattgcact agagcccgcg cagcaaaaac gttatggcga aattagcgcg       480
     cgtttatcag agctggcctc taaatttggc aacaatgtta tggatgccac attggcttgg       540
     cataaacaca ttaccgatga aagtgaactg gctggtttac cagagtcggc gttggcttta       600
     gctgccgata ccgcaaaaag taaagaatta gacggctggg tatttacgct cgattttcca       660
     tcgtacttac ctattatgac ctacgccgat aatcgcgaac tacgcgaaga aacatacaca       720
     gcgttttcta cacgtgcgtc tgatcaaggc cctaatgcgg gtgaatttga taactcagca       780
     attatgagcg aagagctagc gctacgtcat gaactagcac agttgcttgg ctttaatagc       840
     tacgctgaaa agtcacttgc cactaaaatg gctgagacgc ctgcacaagt attctcattt       900
     ttagaagacc tagcggctaa atcaaaacca caagcagagc aagaacttgc agaactacaa       960
     gcctacgcag agcaaaaaca cggtattacc gaactagcag cgtgggattt tggttattac      1020
     ggcgaaaagc tcaagcaaga caaatacgcc atttcagacg aagtactccg cccgtatttt      1080
     ccagctaata aagtattaag tggtttgttt gaaacagtta accgtttatt tggcattagt      1140
     gtaaaagaag tcagtgattt tgacagctac cacaaagatg tacgcttttt tgaaatatac      1200
     gacagcagta atacgctacg tggccgtttt tatctcgact tatatgctcg cgatcataaa      1260
     cgcggtggcg catggatgga cgactgtatg gggcgtaaag tacgcgctag cggcgaattg      1320
     caaacaccag tggcgtattt agtttgtaac tttaacaaag caataggcga taagccggcc      1380
     ttgtttactc ataacgaagt aactacttta ttccatgagt ttggccatgg tattcatcat      1440
     atgctaactc aggtagatgc agcgcctgtt gcaggcatta acggcgttgc atgggatgcg      1500
     gtagagctac caagtcagtt tttagaaaac tggtgctacg aagagcaagc acttagcttt      1560
     atttcagggc attacgaaac tggcgagcca ctaccaaaag agctactaga taagttacta      1620
     gcggctaaaa actataactc gggcatgcaa atgctgcgtc agttagagtt ttcgttattt      1680
     gactttaaaa tacataacga ctacgtagct ggtgagccat gtaatattca agctgtgctt      1740
     aacgacgtac gtagccgcac ctcggtgatt aaagcgccag aatttaaccg ctttcagcat      1800
     ggctttagcc atatttttgc cggtggttat agcgcaggtt attactcgta taaatgggca      1860
     gaagtactct ctgccgatgc ttattctaaa tttgaagaag agggcatttt taacccagaa      1920
     acagggcgag catttatgca gcacatccta gaaaaaggcg gcagtgaaga gccaatggaa      1980
     ttatttaaaa acttccgtgg ccgtgagcca aatgttgacg cattacttcg ccacagcggt      2040
     attgctgcct aa                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page