(data stored in ACNUC7421 zone)

EMBL: CR954246.PRMA

CR954246.PRMA        Location/Qualifiers
FT   CDS_pept        complement(360871..361752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="PSHAa0348"
FT                   /product="methylation of 50S ribosomal subunit protein L11
FT                   (ribosomal protein L11 methyltransferase)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8226664; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85446"
FT                   /db_xref="GOA:Q3IIC0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC0"
FT                   /protein_id="CAI85446.1"
FT                   /translation="MAWIQIRINANADNADLISDLLVEAGSASVTFIDAKDTPIYEPKI
FT                   GTVQFWADTTVIGLFDANHDMDSVVALLNADKSVAQNLTYKIEQLEDKDWEREWMDNFH
FT                   PIQFGKRLWICPSWRDIPDPDAVNVLLDPGLAFGTGTHATTALCLKWLESQDLTGKTVV
FT                   DFGCGSGILGIAAIKLGAERMIGIDIDPQALEASLDNANRNGVADKLEVYLPENQPEFS
FT                   ADIVVANILAQPLRELHSVILGLLKPGGKIAMSGILTEQAQSVADVYAPFIELDDIAIE
FT                   GDWTRVSGTKKA"
     atggcttgga tccaaattcg tattaacgcc aacgctgata acgctgattt aattagtgat        60
     ctactagttg aagctggtag tgcatcggtt acttttattg acgccaaaga cacgcctatc       120
     tatgagccta aaataggcac tgtgcaattt tgggccgata ctacggtaat aggcttattt       180
     gatgctaatc acgatatgga tagcgttgta gcgctgttaa acgcagataa atcagttgcg       240
     caaaatctaa catataaaat agaacaactt gaagacaaag attgggaacg tgagtggatg       300
     gataactttc acccgatcca atttggcaaa agactttgga tttgcccaag ctggcgcgat       360
     attcctgatc ctgatgcagt aaacgtattg ctcgacccag gccttgcatt tggtactggc       420
     actcacgcga ctaccgcatt gtgtttaaaa tggcttgaaa gccaagactt aaccggtaaa       480
     actgtggttg attttggttg tggctcgggc attttgggca ttgctgctat taaacttggc       540
     gcagagcgca tgattggtat agatatagac ccgcaagcac tagaagcgag cttagataat       600
     gctaaccgta atggtgttgc cgacaaatta gaagtatacc tgccagaaaa ccaacctgaa       660
     tttagtgccg atatagtcgt tgctaatatt ttagcgcaac cgttacgtga actacatagt       720
     gttattttag ggttattaaa acccggtggc aaaatagcta tgtcgggaat tttaaccgag       780
     caagcgcaat cggttgccga tgtttatgcc ccctttattg agctggacga cattgctatt       840
     gaaggtgatt ggacccgtgt aagtggcact aaaaaagcat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page