(data stored in ACNUC7421 zone)

EMBL: CR954246.PROA

CR954246.PROA        Location/Qualifiers
FT   CDS_pept        295205..296452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="PSHAa0280"
FT                   /product="Gamma-glutamyl phosphate reductase (GPR)
FT                   (Glutamate-5-semialdehyde dehydrogenase)
FT                   (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA
FT                   dehydrogenase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="1.2.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6089111, 3026898; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85379"
FT                   /db_xref="GOA:Q3IEY7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY7"
FT                   /protein_id="CAI85379.1"
FT                   /translation="MSLITDISRQAAKAAHQLALLDTETKNKVLLDMAAALRAEKAFII
FT                   KENESDLAAARDNNLAAAMVDRLTLNDERVEAMAEGIEVIVSLDDPVGQLRDITERPNG
FT                   IKIRKMRVPLGVVCMIYEARPNVTADAGALCFKSGNSVILRGGKEALKSSQAIASVMHS
FT                   VLAKHNLPEALISVIPDPDRGLLMELMQQRDSIDLIIPRGGEGLINFVTENSTIPVIQH
FT                   FKGVCHLYVDKDADLEVAINLLLNGKTQRTGVCNALEGLVVHQDIANEFLNLCAVVLRQ
FT                   EGVKINADSQAATYFDNATVLGDDEFGEEYLDLEIAIRVVPSFAAAVEHIAQFGSHHTE
FT                   VICTKNAATAELFQRSVDASVVTVNASSRFSDGSQLGLGAEIGIATSKLHAYGPMGLES
FT                   LTTEKYLVNGDGQIRE"
     atgagtttaa ttacggatat ttcacgccag gcagcaaaag ctgctcatca gttagcgtta        60
     ctcgataccg agacaaaaaa taaagtgcta ttggacatgg ctgcagcact acgtgcagaa       120
     aaagcattta ttattaaaga aaacgaaagc gatttagccg cggcacgcga caataactta       180
     gcagcagcaa tggttgaccg tttaacgctt aacgatgaac gtgttgaagc aatggctgaa       240
     ggcatcgaag tgatagtaag cttagatgat ccggttggtc agctacgcga tattaccgag       300
     cgtccaaatg gcattaaaat tcgtaaaatg cgcgtaccac taggcgtagt ttgtatgatt       360
     tacgaagcgc gcccaaatgt aaccgcagat gcgggtgcat tgtgttttaa atcgggtaat       420
     agcgttattt tacgcggcgg taaagaagca ctaaaaagct cacaagcaat tgctagcgta       480
     atgcacagcg tgctagcaaa gcataattta ccagaagcac ttatttcggt aattcctgac       540
     cccgatcgtg gcttattaat ggaattaatg cagcaacgtg acagcattga tttaattata       600
     ccgcgtggtg gtgaagggtt aataaacttt gtaaccgaaa acagcacaat accagtgatc       660
     caacacttta aaggtgtatg tcatttatat gttgataaag acgccgacct tgaagtggca       720
     attaacctac tgcttaatgg taaaacgcaa cgcaccggcg tgtgtaatgc tttagaaggc       780
     ttagttgtac atcaagatat tgccaatgag tttttaaact tgtgtgcggt agtgttacgt       840
     caagaaggcg ttaaaattaa tgccgatagc caagcagcta cgtattttga caatgcaaca       900
     gtactgggcg acgatgaatt tggtgaagag tatttagatt tagaaatagc cattcgcgtg       960
     gttccaagtt ttgcggcagc tgtagagcac atagcgcaat ttggttcgca tcatacagaa      1020
     gtaatttgta ctaaaaacgc tgctacggca gagttattcc aacgtagtgt tgatgcttcg      1080
     gtagtaactg ttaacgcttc atcgcgtttt tcagacggtt cacaactggg cttaggtgcc      1140
     gagattggta ttgcaacgtc taagctacat gcctacggac ctatgggcct tgagtcacta      1200
     actactgaaa agtatttagt taatggcgac ggtcagatcc gcgaataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page