(data stored in ACNUC7421 zone)

EMBL: CR954246.PROB

CR954246.PROB        Location/Qualifiers
FT   CDS_pept        294102..295208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="PSHAa0279"
FT                   /product="putative glutamate 5-kinase (Gamma-glutamyl
FT                   kinase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="2.7.2.11"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6089111; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85378"
FT                   /db_xref="GOA:Q3IEY8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY8"
FT                   /protein_id="CAI85378.1"
FT                   /translation="MNKLNWRRIVLKVGSALIAPDQDGCRSRYILTIAQFIVRCRARGI
FT                   EVILVSSGSVAAGAHLFPSDTARSVVMKKAMAAAGQTEMIAMWDRFFDFPSAQLLLTHG
FT                   DLRDHERYQSIRETVFTLLEHGVLPIINENDAVTTDDLKVGDNDNLSAMVAAAADADAL
FT                   LIFSDVDGLYDKNPNLHDDAILLPEIKSIDDSIYAMAGCATSAVGTGGMKTKIEAAEKA
FT                   TSHGISTYIINGFKEETFTRLLAGENPGTIFLPYEKPMQDSVHWMTHTANEQGEVVVDG
FT                   SFDKSLEGETGCIRGDEIMAVHGEFAIGDTILVRSEDGTRLAKATANYSSCLLSFIADN
FT                   EQSEFSEKMQDSIGPVISEKHIALLEKS"
     atgaataagt taaattggcg acgtatagta cttaaagtag gtagtgcttt aattgcaccg        60
     gatcaagatg gctgccgttc acgttacata ttaaccattg cacagtttat tgttcgctgt       120
     cgtgctcgtg gtattgaagt tattttagtt tcgtcaggct cagttgctgc gggggcacat       180
     ttgttcccat cagatacagc acgttcagtc gtgatgaaaa aagcaatggc tgccgcaggt       240
     caaacagaaa tgatagcaat gtgggatagg ttttttgact ttccatcagc tcaattatta       300
     ttaacccacg gtgacttacg tgatcatgaa cgctatcaaa gtattcgcga aactgtattt       360
     actttacttg agcacggcgt gttacctatt attaatgaaa atgatgcagt aacaaccgat       420
     gatctaaaag taggtgataa cgataactta tctgctatgg ttgcagcagc agctgatgca       480
     gacgcactgc ttatattttc agatgtggat gggttatatg ataaaaaccc taacttgcat       540
     gacgatgcta ttttactgcc tgaaataaaa tcaattgatg actctattta tgctatggca       600
     ggatgtgcaa ctagcgcagt tggtacaggc ggtatgaaaa ccaaaattga agcggctgaa       660
     aaagcaacct cacatgggat ttcaacttat attattaacg gctttaaaga agagacattt       720
     acgcgtttac ttgcaggtga aaaccctggg actattttct taccatacga aaaaccaatg       780
     caagattctg tacattggat gacgcacact gcaaatgagc agggtgaagt tgttgtagat       840
     ggctcgtttg ataagtcact cgaaggcgaa acaggctgta ttcgtggcga tgaaataatg       900
     gccgtacatg gcgagttcgc aattggtgac actattttag tacgcagtga agatggtacg       960
     cgtttagcca aagcaaccgc aaattatagt agctgtttgt tgagctttat tgctgacaac      1020
     gaacagagtg aattcagcga aaaaatgcag gactcaattg gacctgttat atctgaaaaa      1080
     catatcgcat tattggagaa gtcatga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page