(data stored in ACNUC7421 zone)

EMBL: CR954246.PSD

CR954246.PSD         Location/Qualifiers
FT   CDS_pept        complement(503857..504684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="PSHAa0486"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3042771, 8244943, 12900013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85582"
FT                   /db_xref="GOA:Q3IFN3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN3"
FT                   /protein_id="CAI85582.1"
FT                   /translation="MPKHFISRVVGKLAAAKAGVLTTTLIKLFIKQYKVDMSEAKHPDP
FT                   AHYESFNEFFTRPLKDGARPIVADSDIIIHPVDGAISQLGDIVDGQLIQAKGHDYSLQA
FT                   LLGGNKDDTTPFLGGKFATIYLAPKDYHRIHMPIDGTLSKMIYVPGDLFSVNPLTAQNV
FT                   PNLFARNERVVAIFETEIGPLAMVLVGATIVASIETIWAGTVTPPAGSDVFSWNYPTKG
FT                   ENAISLKKGEEMGRFKLGSTVVLAWGDDKADILDDQLPETVTRLGTPFAKIDD"
     atgccaaaac actttatttc acgcgtagta ggaaaactag ccgctgctaa agcgggtgtg        60
     ttaacaacca cgttaattaa actgtttatt aagcaataca aagtagatat gagtgaagct       120
     aaacacccag atcctgctca ttatgaaagc tttaacgagt ttttcacccg tccgttaaaa       180
     gatggcgcac gcccaatagt tgcagacagc gacattatta ttcatccagt agatggcgca       240
     attagccaat taggcgatat tgttgacggc caactaattc aagctaaagg tcacgattac       300
     agcctacaag cactacttgg tggtaataaa gacgatacaa ccccattttt aggcggtaag       360
     tttgcaacta tttatttagc gccaaaagac taccaccgta ttcatatgcc aattgatggc       420
     acattaagta aaatgattta cgtaccaggc gatttatttt cagtaaatcc gctgactgcg       480
     caaaacgtgc ctaacttgtt tgcacgtaac gaacgtgtgg ttgctatttt tgaaactgaa       540
     ataggcccac ttgctatggt actggttggc gcaactattg ttgccagcat tgaaactatt       600
     tgggcgggta cagtaacacc accagctggt agcgatgtat ttagctggaa ctacccaacc       660
     aagggcgaaa acgctattag ccttaaaaaa ggtgaagaaa tgggccgctt taaacttggc       720
     tctaccgtgg tacttgcttg gggcgacgac aaagcggata ttcttgatga tcaacttcct       780
     gaaacagtga cccgcttagg caccccgttt gccaaaattg atgattaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page