(data stored in ACNUC7421 zone)

EMBL: CR954246.PSPA

CR954246.PSPA        Location/Qualifiers
FT   CDS_pept        516432..517112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="PSHAa0500"
FT                   /product="putative negative regulatory gene for the psp
FT                   operon, phage shock protein A"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 1712397; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85590"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG91"
FT                   /protein_id="CAI85590.1"
FT                   /translation="MGIFNRVTDIVQANIVSILDKAEDPEKSLNLMLSEMQDALTECRI
FT                   TTAALLCEEKTLKRQIENKNNNLVYWQDKAELAIERGRDDLAKSALLEKQTISNTVVAK
FT                   QLQLETLQQSIAKMTADCQRLQQRIAEAKAKQTQLVQRHNIVAARGQINSQLQSEKVAH
FT                   ALSRFEKVEQRVEGIEAQVEAYELTDSENTIAAQIDALVKNEQVDAELARLKADLKTNL
FT                   KQSA"
     atgggaatat ttaatcgcgt aaccgatatt gttcaagcaa atatagtgtc gatattagac        60
     aaggcagaag atccagaaaa atcacttaat ttaatgctca gcgagatgca agatgcactt       120
     actgagtgtc gcattacgac agcggctttg ttgtgcgaag aaaaaacact taaacgtcaa       180
     attgaaaata aaaataacaa tttagtatat tggcaggata aagctgagct agcaatagag       240
     agaggtcgag atgatttagc aaaatcagct ttgcttgaaa aacaaaccat tagtaacaca       300
     gttgtagcaa agcagctgca actagaaacg ctgcagcaat caatagctaa aatgacagcg       360
     gattgtcagc gtttgcaaca aagaatagcc gaggctaaag ccaagcaaac acagttagta       420
     cagcggcaca atatagtggc tgcaaggggg caaataaata gccaattaca aagtgaaaaa       480
     gttgcacatg cactctctcg atttgagaaa gtagagcagc gcgtagaagg tattgaagca       540
     caggtagaag cgtacgagct tactgattca gaaaatacta tagctgcaca aatagacgct       600
     ttggtgaaaa acgaacaagt agatgcagaa ttagctcgct taaaagctga tttaaaaact       660
     aacttaaaac agagtgctta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page