(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTA

CR954246.PSTA        Location/Qualifiers
FT   CDS_pept        323997..325646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="PSHAa0310"
FT                   /product="putative phosphate transport system permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85409"
FT                   /db_xref="GOA:Q3ILC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC6"
FT                   /protein_id="CAI85409.1"
FT                   /translation="MVKQWFRSGSPWIWMTGGAVSISLISVIGLLAMIAWKGLSFFWPS
FT                   EVVQFELEGSIAKQTIIGEIYDRELVPKARLAATGVDVSAYDREEFERLLIKTGNREYV
FT                   DLDFRWILNTDIKNQSTPTTLAVFERSKNGNFYGYVEGVIEDGQPVTGDKVAYLHKLVE
FT                   RAVDLNDEALDLQNGDIGHINYELERLRLKEKSYLLDNELTDERVAELAEARAELRAEY
FT                   AVLEKQLFALRKQAQRDQVMVKDMRGEIVTIPLYQVLDVWFPNDMSFLTKLGHYFIQLG
FT                   KFVSDDPREANTEGGVFPAIFGTVFMVMLMAVIVTPFGVVAAIYLHEYAAKNAVTKMIR
FT                   IAVINLAGVPSIVYGVFGLGFFVYMLGGSLDQLFYPESSPTPVFGTPGVMWSALTLAIL
FT                   TLPVVIVSTEEGLSRIPSTVRHGSLALGATQAETLWRIVIPMASPAIMTGLILAVARAA
FT                   GEVAPLMLVGVVKMAPTLPLDGNFPYFHLDRKFMHLGFHIYDVGFQSPNVEAARPLVYA
FT                   TAFLLVSVIITLNITAIGIRNHLREKFRSLEL"
     atggtaaagc agtggtttag gtctggttct ccttggattt ggatgaccgg tggtgcggtg        60
     agcatcagct taatttcagt aattggttta ttagctatga tagcgtggaa agggttaagc       120
     tttttctggc cttctgaagt agtgcaattt gagctggaag gctcaattgc aaaacaaact       180
     attattggtg aaatttacga tcgagaatta gtacccaaag cgcgtttagc ggcaaccggt       240
     gttgatgttt cggcatatga tagggaagaa tttgagcggt tattaattaa aaccggtaac       300
     cgtgaatatg tagatttaga ttttcgttgg atattaaaca ccgacataaa aaaccaatca       360
     acgcctacca ctcttgccgt gtttgagcgt agcaaaaatg gtaattttta tggctacgta       420
     gaaggcgtaa ttgaagacgg acaacctgtt accggcgata aggtagccta tttacataag       480
     ctggttgaac gggcagttga tttaaacgac gaagcacttg atttacaaaa cggtgatatt       540
     ggtcatatta actatgaact ggaacgtcta aggctaaaag aaaaatccta cttacttgat       600
     aatgaactaa cagacgaacg tgttgctgag cttgcagagg cgcgtgcaga actacgtgcc       660
     gagtatgcgg tgctcgaaaa gcaactgttt gcactgcgta aacaagcaca gcgcgaccaa       720
     gttatggtta aagatatgcg cggcgaaata gtcaccattc cattgtatca agtattagat       780
     gtgtggtttc caaatgacat gagcttttta accaaactgg gccattactt tatccaatta       840
     ggtaagtttg tatcagacga ccctcgcgaa gcaaataccg aaggtggcgt atttccggcc       900
     atatttggta ccgtgtttat ggttatgcta atggctgtta ttgtgacgcc atttggggtg       960
     gttgctgcaa tttacttgca tgaatacgcg gctaaaaatg cggtaactaa gatgatccgt      1020
     attgcggtaa ttaacctagc cggtgtacct tctattgtat atggtgtatt tggcttaggc      1080
     ttttttgttt atatgctagg tggcagcctt gaccaattat tttatcctga gtcatcacct      1140
     actccggtat ttggtacacc aggtgttatg tggtcggctt taacactggc aatacttacc      1200
     ttgcctgtgg ttattgtttc cactgaagag ggactatcgc gtattccaag tacggtacgc      1260
     cacggatcat tagcgcttgg tgccacacaa gcagaaacct tatggcgtat tgttatacct      1320
     atggcaagcc cagcaattat gacaggttta atactggctg ttgcgcgtgc agcaggtgaa      1380
     gtagcgccat taatgctggt gggtgtagta aaaatggcac ctacgttacc gcttgatggt      1440
     aactttccat actttcactt agacagaaag tttatgcact taggttttca tatttacgat      1500
     gttggctttc aaagcccgaa tgttgaagcg gcacgaccgc tggtatatgc aacggcattt      1560
     ttattagtgt cggtaattat taccctcaac ataaccgcta ttggtatacg taatcattta      1620
     cgtgaaaaat tcagatcgct tgagctttaa                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page