(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTB

CR954246.PSTB        Location/Qualifiers
FT   CDS_pept        325669..326496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="PSHAa0311"
FT                   /product="Phosphate import ATP-binding protein
FT                   pstB(Phosphate-transporting ATPase)(ABC phosphate
FT                   transporter)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.6.3.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2993631, 3881386, 8682808; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85410"
FT                   /db_xref="GOA:Q3ILC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILC5"
FT                   /protein_id="CAI85410.1"
FT                   /translation="MISVAPKVNQANTSLKLDLDNLTTEQTALEIKDLDLYYGDKQALS
FT                   KVNMNIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVDICRIEGEILLHGQNIYDKSVDV
FT                   AALRRNVGMVFQRPNPFPKSIYENVVYGLRLQGIKDKRKLDEVVEQSLRGAALWDEVKD
FT                   RLHDSAFGLSGGQQQRLVIARSIAISPEVLLLDEPTSALDPISTLVIEELINDLKSKFT
FT                   VVIVTHNMQQAARVSDQTAFMYMGELIEYSDTNTLFTTPNKKKTEDYITGRYG"
     atgatttcag tcgctccaaa agtaaatcaa gccaatacca gcttgaagtt agacttagac        60
     aatttaacca cagagcaaac agcgttagag attaaagatc tcgatcttta ctacggcgat       120
     aaacaagcgc tgagtaaagt aaatatgaat attccaaagg gccaggtaac agcctttatt       180
     ggcccgtcgg ggtgtggtaa atcaacctta ttacggtgta ttaaccgcat gaacgactta       240
     gttgatattt gccgcataga aggtgaaata ctgctacatg gacaaaacat ttacgataaa       300
     agcgttgatg tagcggcgct gcgtcgtaac gtaggcatgg tatttcagcg acctaaccct       360
     tttcctaaat caatttatga aaatgtggtt tatggtttgc gcttacaagg tattaaagac       420
     aaacgtaaat tagatgaagt agttgagcaa tcattgcgtg gtgcagcgct gtgggatgaa       480
     gtaaaagaca ggctacacga cagcgctttt gggttgtcgg gtggacagca gcaacgttta       540
     gttattgcgc gctcaattgc tatttcgcca gaagtattac tgcttgatga acctacctcg       600
     gcactagacc ctatttctac tttagtaata gaggagctaa ttaacgattt aaagagcaag       660
     tttacagtgg taattgttac ccataatatg caacaggccg cccgggtttc tgaccaaacg       720
     gcgtttatgt atatggggga gctaattgaa tactcagaca ccaacacctt atttacaacg       780
     cctaataaga aaaaaacaga agactatata accggtcgtt acggctaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page