(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTC

CR954246.PSTC        Location/Qualifiers
FT   CDS_pept        321748..323982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="PSHAa0309"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2993631, 3881386; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85408"
FT                   /db_xref="GOA:Q3ILC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC7"
FT                   /protein_id="CAI85408.1"
FT                   /translation="MTSNPNKPTFNTDRSRLFKDRLAQFGITVGGVMVLIALLLIFFYL
FT                   LYIVQPIFESAKVEKRDSFNLTNAEQIVGVGVEEQTEVAYLLSQQGSVDFYSVEKANFG
FT                   KKLKTLEVTLPSDVSSFATSAPFQGQYAYGLENGSVKIVIPKFMVTFPNNERKLTPRLD
FT                   YPLGELALEVDEQGAAIKRFAFSHFEDKTAVVALTADKRVLFSSFVAEENMFSGEVEWL
FT                   VERTELDVAGRVDELLMSPDTTRVFVRSANQIYVYDTRDPSEVEQIQLLSANEENANIV
FT                   AAQLLAGANSLMLANDNGKVSQWFEINTDSGREYQKIRSFETTKQSKLNVFTEFYRRTF
FT                   FTTSSNGELGVYYTTSQAKLWQGKVSEGAIKSFAIAPRANAALIVADNKLTVLEIHNEH
FT                   PEVTWSALWQEVWYEGYPEPGYIWQSTSASDDFESKFSLVPISFGTLKAAFYAMLFAVP
FT                   IAISAAIYTAYFMSSELRKVVKPTVEIMEALPTVILGFLAGLWLAPLIEQHLPAIVGLL
FT                   VLLPLGILATALGWTKLPASIRHKIPEGSHAIILIPVVLFIGWFSFAMSETVELWMFDG
FT                   NVRQYLTNELGMTFDQRNALVVGIAMGFAVIPTIFSIAEDAVFSVPKHLSNGSLALGAT
FT                   QWQTLIRVVLLTASPGIFSAVMMGLGRAVGETMIVLMATGNTPIMDWSVFQGMRTLAAN
FT                   IAVEMPESEVGSSHYRILFLAAFVLFIFTFVFNTIAEFVRQQLREKYSSM"
     atgacttcca atccgaataa gccgactttt aatacggatc gaagccgtct atttaaagac        60
     cgacttgccc agtttggcat aaccgtaggt ggagtaatgg tattaatagc gctgctatta       120
     atttttttct accttcttta tatagtacag ccaatttttg aatcagctaa agttgaaaag       180
     cgcgacagtt ttaatcttac aaacgcagag caaatagtgg gagtaggcgt tgaggaacaa       240
     actgaagttg cttatttatt aagccagcaa gggagtgttg acttttatag tgttgaaaaa       300
     gctaactttg gtaaaaagct aaaaacgcta gaggtaaccc tgcctagcga tgtgagtagc       360
     tttgctacca gtgcaccgtt tcaggggcaa tatgcttatg gtttagaaaa tggcagtgta       420
     aaaattgtta ttcctaaatt tatggtgacg tttccaaata acgaacgtaa attaactccg       480
     cgtttagatt atccgctagg cgaacttgct ttagaggtag acgagcaagg tgctgctata       540
     aagcgttttg catttagcca ctttgaagac aaaacagccg ttgttgcgct aacagccgac       600
     aagcgcgttt tatttagtag ctttgttgct gaagaaaaca tgtttagcgg cgaagtagaa       660
     tggcttgtgg aacgcaccga gctagatgtt gctgggcgag tagatgagtt acttatgtcg       720
     ccagatacta cccgagtatt tgtgcgctca gctaatcaaa tttatgttta cgatacgcgt       780
     gacccaagcg aagtagagca aattcaatta ctgtctgcca atgaagaaaa cgctaatatt       840
     gttgcggcgc aattacttgc gggcgctaac tctcttatgt tggcaaacga taatggaaag       900
     gtatcgcagt ggtttgaaat aaataccgat agtggccgtg aatatcaaaa aatccgctca       960
     tttgaaacaa caaagcaaag taagttaaac gtatttactg agttttaccg ccgtaccttt      1020
     tttactacca gtagtaatgg tgagttaggt gtttattaca ccacaagcca agcaaaattg      1080
     tggcaaggca aagtaagcga aggagcaatt aaaagctttg ctatagcacc gcgtgcaaat      1140
     gcagcgctaa ttgttgccga caacaaacta accgtattag aaattcataa cgaacaccca      1200
     gaagttactt ggtctgcact ttggcaagaa gtgtggtacg aaggttaccc agagcctggt      1260
     tatatttggc aatcaacctc agccagtgac gactttgagt ctaagttttc gttagtgcct      1320
     atttcgtttg gtactttaaa ggcggcattt tacgccatgc tatttgccgt acctatcgcg      1380
     atttctgctg ctatttatac cgcttacttt atgtcgagtg aactgcgtaa agtggttaag      1440
     ccaacggtag aaataatgga agcacttcct accgttattt tggggttttt agcgggccta      1500
     tggttagcgc ctttaataga gcagcactta ccagccatag ttggcttact ggtgttatta      1560
     cctttaggta ttttggctac tgcgcttggt tggactaaat taccagccag tattcgccat      1620
     aaaattcctg aaggatcgca tgccattata cttataccgg tagtgttatt tattggttgg      1680
     ttttcgtttg cgatgagcga aactgttgag ctgtggatgt ttgatggtaa cgtgcgccaa      1740
     tatttaacta acgagcttgg catgaccttc gatcagcgta atgccttggt agtgggtatt      1800
     gcgatgggct ttgctgtaat tcctactata ttttcgattg cggaagacgc ggtatttagc      1860
     gtgcctaagc atttgtctaa tggctcactg gcactgggtg caacacagtg gcaaacactg      1920
     atacgcgtgg tattacttac cgccagccct ggaatatttt ctgcggtaat gatgggcctt      1980
     ggccgcgcag taggcgaaac catgatagtg cttatggcaa ccggtaatac cccgattatg      2040
     gattggagtg tgtttcaggg aatgcgtacg cttgcggcaa atattgcggt tgaaatgcca      2100
     gagtcggaag tgggtagttc gcattacaga atattgtttt tagcagcatt tgtattattt      2160
     atatttacct ttgtttttaa caccattgct gagtttgttc gtcagcaact gcgtgaaaaa      2220
     tacagctcaa tgtaa                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page