(data stored in ACNUC7421 zone)

EMBL: CR954246.PTRB

CR954246.PTRB        Location/Qualifiers
FT   CDS_pept        71799..73973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="PSHAa0069"
FT                   /product="oligopeptidase (protease II)"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.83"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1447164; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85178"
FT                   /db_xref="GOA:Q3IF93"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF93"
FT                   /protein_id="CAI85178.1"
FT                   /translation="MKHIPCVLAISSLAILSGCNQAPEAVQTNVISTTAEQLPQVVAPI
FT                   AKKVPHAMTIHGDTRIDNYYWLRDDERKAADVISYLEAENSYTNTMLAHTQAQQAKLFA
FT                   ELKGRIQKDDDSVPIKKGDYYYSSQTRGNNEYTTYVRSSDFSGANQQVILDVNELAKAH
FT                   DYYAVSGLDVSPNGNLMAYGEDTLSRRIYTVKIKDLSTGRLLQDTLEGTSGNLVWANDN
FT                   KTLYYIKKDLQTLLGYQVYRHTLGTPQANDELVYEETDSSYYTGLSKSKDGTEIYIWHS
FT                   SSTASGMSVLSANNVKAMPQRLIKRQANLEYSISKLGESYYIVTNLNAVNFQLMKVAIN
FT                   KAHDQANWQALIPARDDIKLEGIELFNDYLVYQQREMGQSRQIIRNLSTNQEQLLSFND
FT                   SAYTISAYGNNDINSNKLRVYYTSMTTPGSSYDINLKTTDKTLLKQQAVLGNFNVDNYA
FT                   SERIFINARDGVKVPVSLVYRKDKFKKDATNPLLQYGYGSYGATMDPTFSSARLSLLDR
FT                   GFVFAIAHVRGSQMLGRPWYDDGKLLTKKNTFNDFIDVTKALVEQKYGAKDKIFAQGGS
FT                   AGGLLMGAVANQAPELYKGMVAAVPFVDVVTTMLDESIPLTTNEYGEWGNPNEKEYYEY
FT                   MLSYSPYDQVSKQAYPNMLVTTGLHDSQVQYFEPAKWVAKLRDYKTDDNKLLFKIDMEA
FT                   GHGGASGRFKRLEDTALNYAFMLDLMGIKE"
     atgaaacata tcccttgtgt tctagctata tcatctttag ctattttaag tggctgcaat        60
     caggcgcccg aagcagtcca aacaaacgtt ataagtacta cagcagagca gttacctcaa       120
     gttgttgcac ctatagctaa aaaagtgccg cacgccatga ctattcatgg cgatacccgc       180
     attgataatt actattggct gcgtgacgat gaacgcaaag cagccgatgt tattagttac       240
     cttgaggctg aaaatagcta cacaaatacc atgcttgctc atactcaagc gcagcaagct       300
     aaactttttg ccgagcttaa agggcgtatt caaaaagatg acgattcagt accgataaaa       360
     aaaggtgatt attattactc gtcgcaaact cgtggcaata acgagtacac tacttatgtg       420
     cgtagcagtg acttttcagg agctaaccaa caggttattt tagatgtaaa tgaacttgct       480
     aaggctcatg actattatgc tgtaagtggt ttagatgtga gtccaaacgg taacttaatg       540
     gcttacggtg aagatactct cagtagacgt atttataccg ttaaaattaa agatttaagc       600
     accgggaggc tactccaaga tacgcttgaa ggcacaagtg gtaaccttgt ttgggcaaac       660
     gataacaaaa cactgtatta cattaaaaaa gacttacaga ctttgttagg ctaccaggtt       720
     tatcgccata ctttaggtac gccgcaggcc aatgacgaac tagtttacga agaaacagac       780
     tcaagctatt acaccgggtt aagtaaaagc aaagacggta ctgaaattta tatttggcac       840
     agtagtagca ctgcatcagg tatgtcggtg cttagcgcaa ataacgttaa agcaatgcct       900
     caacgcttaa ttaaacgcca agcgaatctt gagtatagta tttctaaatt aggtgagagt       960
     tattatattg tcactaattt aaatgcggtt aattttcagc taatgaaagt cgctattaat      1020
     aaagcacatg atcaagcaaa ctggcaagcg ctgatcccag cacgtgatga tataaagcta      1080
     gaagggatag agttatttaa tgactatttg gtttaccaac agcgtgaaat ggggcaatcg      1140
     cgacaaataa tacgcaattt aagcactaat caagagcagt tattatcttt taacgacagt      1200
     gcctacacta ttagtgctta tggtaataac gatataaaca gcaataagtt acgtgtttac      1260
     tatacgagca tgaccacgcc gggttcatct tacgatataa acctaaaaac aacggataaa      1320
     acgcttttaa aacaacaagc tgtgctaggc aactttaatg ttgataatta cgcatctgaa      1380
     cgtatattta ttaacgcccg cgatggtgta aaagtccccg taagcttagt ttaccgtaaa      1440
     gataaattta aaaaagatgc gacgaaccca ttgctacaat atggttatgg ctcgtatggc      1500
     gccactatgg atccaacttt ttcaagtgcg cgtttaagtt tacttgatcg tggttttgtg      1560
     tttgctattg cccatgttcg aggctcgcaa atgttaggtc gtccttggta tgacgatggt      1620
     aaattactta ctaaaaagaa tacgtttaat gactttatag atgtgactaa agcactggta      1680
     gagcaaaagt atggcgctaa agacaaaata tttgcccaag gcggtagcgc tggtggctta      1740
     ttaatgggcg cagtagcaaa ccaagctcct gaactttaca aaggtatggt tgccgcagta      1800
     ccttttgtgg atgtggttac aaccatgctt gatgaaagta ttccactaac aactaacgaa      1860
     tatggtgagt ggggaaaccc aaatgaaaaa gaatactatg agtacatgct atcttactcg      1920
     ccgtacgatc aagtgtctaa gcaagcgtac cctaatatgc tagtaactac gggtctgcac      1980
     gactcgcaag tacagtattt tgagccagca aagtgggttg ctaagctgcg tgactataaa      2040
     acagatgaca ataagttact gtttaaaatt gatatggaag cagggcatgg cggtgcatca      2100
     gggcgcttta agcgcttaga agataccgcg ctaaactatg catttatgct cgatttaatg      2160
     ggtattaaag agtaa                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page