(data stored in ACNUC7421 zone)

EMBL: CR954246.PURA

CR954246.PURA        Location/Qualifiers
FT   CDS_pept        289024..290337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="PSHAa0275"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2123815, 14701822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85374"
FT                   /db_xref="GOA:Q3IEZ3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEZ3"
FT                   /protein_id="CAI85374.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTDKASLVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLRDNVKCVIGNGVVLSPEALMREIGMLEARGVPVRERLLISAAC
FT                   PLILPFHVALDVARETARGDKPIGTTGRGIGPAYEDKVARRGLRVGDLFNPELFAAKLE
FT                   EVLEYHNFTLVNYYKVDAVDFQKTFDDAMAVADILKAMIVDVTELLDQTRLAGDNILFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGAGFGPLHLDYVLGIIKAYTTRVGSGPFPT
FT                   ELYDGLDKQDPVGKHLGDKGHEFGATTGRLRRTGWLDAVAMRRAVQINSISGFCLTKLD
FT                   VLDGLETLKICTGYKLEDGTVTNVTPLAAEGYEKVTPIYEEMPGWSENTVGVTSLDGLP
FT                   KAAIDYVKRIEELTGVPVDIISTGPDRVETMILRNPFA"
     atgggtaaaa acgttgttgt attaggcacc caatggggtg acgaaggtaa gggtaaggta        60
     gttgacctcc ttacagataa agcatcttta gtagttcgtt atcaaggtgg gcacaatgct       120
     ggccatacct tagtgatcga cggtgaaaag acagttctgc accttattcc atcgggtgta       180
     ttacgtgaca atgttaaatg tgtgattggt aatggtgttg tattatcacc agaagcgcta       240
     atgagagaga ttggcatgtt agaagcacgt ggcgtacctg tacgcgagcg tcttttaatc       300
     agtgctgcat gtccattaat tttgcctttc catgttgcat tagatgtagc ccgtgagact       360
     gcacgtggtg ataagccaat tggtacaact ggccgtggta tcggtcctgc gtacgaagat       420
     aaagtggcac gtcgtggttt gcgcgtaggg gatttattta atcctgaact attcgcagca       480
     aaactagaag aagttcttga ataccataac tttactttag ttaattacta taaagtagat       540
     gctgttgatt ttcagaaaac ctttgatgac gcaatggccg ttgctgatat tttaaaagcg       600
     atgattgttg atgttactga gcttttagat caaacgcgtt tagctggcga caacattttg       660
     tttgaaggcg cacaaggtac gttacttgat atcgatcatg gtacttaccc ttatgtaacg       720
     tcttctaaca ctacagctgg tggcgttgct actggtgctg gttttggccc actacacctt       780
     gattatgtgc ttggtattat taaagcatat actacacgtg ttggttcagg cccttttcct       840
     acagagcttt acgacggcct tgataagcaa gacccagttg gtaagcactt aggcgataaa       900
     ggccatgagt ttggcgcaac cactggtcga cttcgtcgta ctggttggtt agatgccgta       960
     gcaatgcgtc gtgcagtgca aatcaatagt atttctggtt tttgtttaac taagcttgat      1020
     gttttagatg gcttagaaac acttaaaatc tgtactggtt ataagcttga agatggcaca      1080
     gttactaacg taacgccatt agcagctgaa ggttacgaaa aagtaacgcc aatatacgaa      1140
     gaaatgcctg gttggtcaga aaatactgtt ggtgtaacta gccttgatgg tttaccaaaa      1200
     gcagcgattg attacgttaa gcgtattgaa gagctcacag gtgttcctgt tgatattatt      1260
     tctactggtc ctgatcgtgt agaaactatg atacttcgca atccgtttgc gtaa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page