(data stored in ACNUC7421 zone)

EMBL: CR954246.PURC

CR954246.PURC        Location/Qualifiers
FT   CDS_pept        473249..474352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="PSHAa0454"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1534690; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85551"
FT                   /db_xref="GOA:Q3IFR4"
FT                   /db_xref="InterPro:IPR014106"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFR4"
FT                   /protein_id="CAI85551.1"
FT                   /translation="MTSYKVLDVNDDLPIRTKGDVHSGKVRSVYWLTDADSKRLISEKG
FT                   YKVPADTELAIMVISDRISAFDCIWQGENGLNGVPGKGIALNSVAAHWFKLFDEAGLAG
FT                   NHIVDIPHPYVWIVRKASTVKVEAIARQYITGSMWRDYAKGVRDFCGINLPEGLTANQK
FT                   LDKVLITPSTKGIITGVADIPPVDDVNITRSNITNNLSVFNFRAADDVAQYEKLLVEGF
FT                   ELISGELAKLGQIFVDTKFEFGYVEDINGAEQLIYIDEVGTPDSSRIWDEASYKDGKIV
FT                   ENSKEGFRQLLINNVPESDVLLNKDRMDEREQLAKDYILPESVMLEVSNTYVGIASKIV
FT                   GKEIVIPADPRQEVIAILDADYGLIIK"
     atgactagct ataaagtttt agacgtaaac gatgatttac ctattcgtac caaaggtgac        60
     gtacacagtg gtaaagtacg ctcggtttat tggctaaccg acgcagacag caaacgttta       120
     attagcgaaa agggctataa agtaccagcc gatactgagc tggcaattat ggttatttcc       180
     gacagaattt cagcttttga ttgtatttgg caaggcgaaa atggcttaaa tggcgtgcca       240
     ggtaaaggca tagcgttaaa ctcggtggct gcgcattggt ttaagttatt tgatgaagca       300
     ggacttgcgg gtaatcacat tgttgatatt ccgcatccgt atgtttggat tgtacgcaaa       360
     gccagtacgg taaaagtaga agccattgcc cgccaatata ttacaggcag catgtggcgc       420
     gactacgcta aaggtgtacg agacttttgt ggtattaatt taccagaagg tttaacagct       480
     aatcaaaagc tcgataaagt attaattact ccctctacca aaggcattat tactggtgtg       540
     gcagatattc ccccagttga tgatgtaaat ataacgcgta gcaatattac taataaccta       600
     agcgtattta actttagagc ggctgatgat gtagcccaat acgaaaagtt attagtggaa       660
     ggttttgagc taataagtgg cgagctggct aagcttgggc aaatatttgt agataccaaa       720
     tttgaatttg gctatgtaga agatataaat ggcgcagagc agcttattta tattgatgaa       780
     gtaggcacgc ctgattcatc acgtatttgg gatgaggcat cttataaaga tggcaagatt       840
     gttgaaaact caaaggaagg tttccgtcag ctgttaatta ataacgtgcc agagagcgac       900
     gtactactta ataaagaccg catggatgag cgtgagcagc tagctaaaga ttacatttta       960
     cctgagtcag taatgcttga agtgtcaaat acctacgtgg gcattgccag taaaatagtg      1020
     ggcaaagaga ttgttattcc tgctgatccg cgtcaagaag taattgctat tttagatgcc      1080
     gattatggat taattataaa ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page