(data stored in ACNUC7421 zone)

EMBL: CR954246.PURD

CR954246.PURD        Location/Qualifiers
FT   CDS_pept        complement(355015..356304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="PSHAa0343"
FT                   /product="phosphoribosylglycinamide synthetase (GAR
FT                   synthetase)"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85441"
FT                   /db_xref="GOA:Q3IIC5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC5"
FT                   /protein_id="CAI85441.1"
FT                   /translation="MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLEN
FT                   VAINVDDLDGLLQFAQQNNVELTIVGPEIPLVLGVVDKFREHGLAIFGPTAGAAQLEGS
FT                   KSFTKDFLARHNIPSGDYQTFEQVAPALAYLKEKGAPIVIKADGLAAGKGVIVAMTEAE
FT                   AEDAIRDMLAGNAFGDAGSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGD
FT                   AGPNTGGMGAYSPAPVVTDEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDTDGT
FT                   PKVIEYNCRFGDPETQPMMLRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKG
FT                   YPGDYPKGDVISGLQVDYPAGEKVFHAGTKQNGNDVVTAGGRVLCATALGNTVTEAQQR
FT                   AYELIKQLSWDGMEYRTDIAYRAIAREQNS"
     atgaatgttt tagtcattgg cagcggcggc cgcgaacacg ctcttgcgtt taaagccgct        60
     caaaacacca aagtaaacac agtatttgta gcccctggta atgcgggcac agcacttgag       120
     ccaaaacttg agaacgttgc aataaatgtt gacgacttag acggtttact tcagtttgca       180
     caacaaaata atgttgagct tactattgta ggccctgaga tcccgttagt attaggtgtg       240
     gttgataagt ttcgtgaaca cggcctagct atatttggcc caacagcggg cgcagctcag       300
     cttgaaggct caaagtcgtt tactaaagac tttttagcgc gtcacaatat ccctagtggc       360
     gattaccaaa cctttgaaca ggttgcccct gcccttgctt atttaaaaga aaaaggcgcg       420
     ccaattgtaa tcaaagcaga tggtttagcc gcaggtaaag gcgttattgt tgcgatgact       480
     gaagccgagg ctgaagatgc tattcgtgac atgcttgcgg gtaatgcttt tggtgatgct       540
     ggtagccgcg tagttatcga agagttttta gaaggtgaag aagcgtcttt cattgtgatg       600
     gtagatggca aaaacgtatt accatttgcc actagccaag atcataaacg cgcttacaat       660
     ggcgatgctg gccctaacac tggcggtatg ggtgcttatt cacctgcgcc agtagttacc       720
     gatgaaattc atcagcgtat tatgaacgaa gtgatttacc caacggtaga gggcatggcg       780
     agcgagggtc atccgtacac aggcttttta tacgctggct taatgataga taccgatggc       840
     acgccaaaag taattgagta taactgtcgt tttggcgacc cggaaactca acctatgatg       900
     ctacgtttgc aatcagactt agtcgagtta attgaagcgg ctaatcgtgt tgaactggat       960
     aaaaccacca ttgagtttga tccacgtgca gccgttggtg tagtactggc cgctaaaggc      1020
     tatcctggtg attatcctaa aggcgatgtt atatcgggtt tacaggttga ctaccctgct      1080
     ggcgaaaaag tatttcatgc tggtactaaa caaaacggta atgacgtagt aactgcgggc      1140
     ggacgtgtat tatgtgccac cgcactgggt aataccgtaa ccgaagcgca gcaacgcgct      1200
     tacgagctaa taaagcaact cagctgggat ggcatggaat atcgtactga tattgcatat      1260
     cgtgctattg cgagagagca aaatagttaa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page