(data stored in ACNUC7421 zone)

EMBL: CR954246.PURH

CR954246.PURH        Location/Qualifiers
FT   CDS_pept        complement(357249..358835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="PSHAa0345"
FT                   /product="bifunctional purine biosynthesis protein
FT                   purH[Includes:IMP cyclohydrolase (Inosinicase) (IMP
FT                   synthetase) (ATIC);Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase) ]"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85443"
FT                   /db_xref="GOA:Q3IIC3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC3"
FT                   /protein_id="CAI85443.1"
FT                   /translation="MDTHRPIRRALLSVSDKTGIVEFARALEAQGVDILSTGGTCKLLA
FT                   DNGIKVTEVSDHTGHPEIMDGRVKTLHPKIHGGILARRGQDESVMAENNISAIDIVVVN
FT                   LYPFANTVAQENCSLEDAIENIDIGGPTMVRAAAKNHKDVTIVVNASDYDRVISEMQSN
FT                   KGSTTYKTRFDLAIAAYEHTAQYDGMIANYFGKMVPDYTEEAAEDTKFPRTINMQFTKK
FT                   QDMRYGENSHQDAAFYVENDIVEASVATATQLQGKALSFNNIADTDAALECVKEFDVPA
FT                   CVIVKHANPCGVSIGSNILEAYERAFKTDPTSAFGGIIAFNQELDAATAEAIVERQFVE
FT                   VIIAPSVSDAAAKIVSAKQNVRLLVCGQWTDKAAGQDIKRVNGGILVQDRDLGMVTQGD
FT                   LKVVSKRQPTEQELKDLLFCWKVAKFVKSNAIVYARDGMTIGVGAGQMSRVYSAKIAGI
FT                   KAADENLEVKGSVMASDAFFPFRDGIDAAAAAGITAVIQPGGSMRDAEVIAAADEAGMA
FT                   MVLTGMRHFRH"
     atggatacac atcgtcccat tcgtcgcgca ctattaagtg tgtctgataa aaccggtata        60
     gttgaatttg cccgcgcatt agaagcgcaa ggtgttgata ttttatcaac tggcggtacc       120
     tgtaaactac ttgctgataa cggcataaaa gtcactgaag tatcagatca cactggtcac       180
     ccagaaatca tggatggccg cgtaaaaaca cttcatccaa aaattcacgg cggcatttta       240
     gcgcgtcgcg gacaagatga aagcgtaatg gcagaaaaca atatttctgc tatcgacatt       300
     gttgtagtta acttataccc ctttgcgaat actgtcgctc aagaaaactg cagccttgaa       360
     gatgctattg aaaacataga tattggcggc ccgactatgg ttcgcgcagc ggctaaaaat       420
     cataaagacg ttactattgt ggtaaacgcc agcgactacg accgcgtgat cagcgaaatg       480
     caaagcaaca agggttctac tacctataaa acccgttttg accttgctat agcagcctac       540
     gagcacaccg ctcagtacga tggcatgatt gctaattact tcggtaaaat ggttcctgat       600
     tacacagagg aagctgccga agatactaag ttcccacgca ctatcaatat gcagttcact       660
     aaaaagcaag atatgcgcta cggcgaaaac tcgcatcaag acgcggcttt ttatgttgaa       720
     aacgacattg ttgaagcttc agtagcaaca gcaactcagc tgcaaggtaa agcgttatct       780
     ttcaacaaca ttgctgatac cgatgctgcg cttgagtgtg ttaaagaatt tgacgtacca       840
     gcctgtgtaa tcgtaaaaca tgcaaaccca tgtggcgtgt ctatcgggag caatattctt       900
     gaagcatatg aacgtgcttt taaaaccgac cctacatcgg catttggtgg cattattgcc       960
     tttaaccaag agttagatgc agcaaccgca gaagcaattg ttgagcgtca atttgtggaa      1020
     gtaattattg ctcctagcgt atctgatgct gcagcaaaaa ttgtttcggc taaacaaaac      1080
     gtacgtttat tagtatgtgg acagtggaca gataaagccg caggacaaga cattaaacgc      1140
     gttaatggcg gtattttagt gcaagaccgc gacttaggca tggtaacgca aggcgattta      1200
     aaagttgtat ctaagcgtca acctactgag caagagctta aagacttatt attttgctgg      1260
     aaagtagcta aatttgttaa atctaacgcc attgtatatg cccgtgacgg tatgacaatc      1320
     ggtgtaggcg cgggccaaat gagccgcgtt tactcggcta aaattgccgg tattaaagca      1380
     gcagatgaaa accttgaagt taaaggttca gttatggcat cagatgcatt tttcccattt      1440
     cgtgatggta ttgacgcagc tgcagccgct ggcataacgg cagtaattca gccaggtggc      1500
     tcaatgcgtg atgcagaagt gattgccgca gcagacgaag ctggcatggc aatggtactt      1560
     actggtatgc gccacttccg ccactaa                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page