(data stored in ACNUC7421 zone)

EMBL: CR954246.QUEA

CR954246.QUEA        Location/Qualifiers
FT   CDS_pept        333540..334571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="PSHAa0318"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase (Queuosine biosynthesis
FT                   protein )"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="2.4.2.29"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1706703; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85417"
FT                   /db_xref="GOA:Q3ILB9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILB9"
FT                   /protein_id="CAI85417.1"
FT                   /translation="MRVADFSFDLPDELIARFPKQDRTSSRLLSLDGPSGVVEHKVFSD
FT                   LLELVNENDLLVFNNTRVIPARMFGQKASGGKVEVLVERVLDEHRVLAHVRASKSLKPG
FT                   NEVILEGKAKATMVARHDTLFELEFEHSQNVLDILNDIGHMPLPPYIDRPDNEADRERY
FT                   QTVYGEKPGAVAAPTAGLHFDDKLMTALKNKGVQMAFVTLHVGAGTFQPVRVATVDEHI
FT                   MHSEYIEVPDDVVAAVANTKANGGRVIAIGTTSVRSLESAAKVHGGKLDTYFGDTDIFI
FT                   YPGYQFNVVDAMITNFHLPESTLIMLVSAFAGQNNIMGAYNTAIEQQYRFFSYGDAMFL
FT                   TRK"
     atgcgcgtgg ctgattttag ctttgacctt cccgacgaat taattgctcg ttttcctaag        60
     caagacagaa caagtagccg cttattgagc ctagatggcc caagtggcgt agttgagcac       120
     aaagtattta gtgatttgct tgaattagtt aacgaaaacg acttgttggt gtttaataac       180
     acgcgagtaa tacctgcccg tatgtttggt caaaaagcgt caggcggaaa agttgaagta       240
     ttagtagagc gtgtgcttga tgagcataga gtgctggcac atgtacgcgc gagtaaatcg       300
     ctaaagcctg gcaacgaagt aattcttgaa ggcaaggcaa aagcaaccat ggttgcgcgt       360
     cacgatacct tatttgagct ggagtttgag catagccaaa acgtactcga tatattaaat       420
     gatattggcc atatgccatt accgccgtat atagatcgcc ctgataacga ggctgatcgt       480
     gagcgttatc aaaccgtgta cggcgaaaag cctggagcgg ttgcggctcc taccgccggt       540
     ttgcattttg acgataagtt aatgaccgcg ctaaaaaata aaggcgtaca aatggctttt       600
     gttacactgc atgtgggagc agggacgttt caaccggtgc gtgttgccac ggtagatgag       660
     cacattatgc actcagaata catagaagtg ccagatgatg tggttgctgc tgtagcaaac       720
     actaaagcca atggtgggcg tgttattgcc ataggtacaa cgtctgtacg ctctctagaa       780
     tcggcagcaa aagtacacgg tggtaagtta gatacttact ttggtgatac cgatatattt       840
     atttatccgg gttatcaatt taatgtggtt gatgccatga tcacgaactt tcacttacca       900
     gagtcaacgc ttattatgct ggtaagtgcc tttgccggac aaaacaatat tatgggcgca       960
     tataacaccg ccatagagca gcagtatcgt ttttttagtt atggcgatgc gatgttttta      1020
     acccgtaaat aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page