(data stored in ACNUC7421 zone)

EMBL: CR954246.RBN

CR954246.RBN         Location/Qualifiers
FT   CDS_pept        180651..181553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="PSHAa0171"
FT                   /product="tRNA processing exoribonuclease BN; required for
FT                   maturation of tRNA encoded by bacteriophages; dimer"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10625642; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85274"
FT                   /db_xref="GOA:Q3IJ43"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ43"
FT                   /protein_id="CAI85274.1"
FT                   /translation="MNDKLSYYKQQVGSFLRQQPGWWMQYINRCIDDQITVNAGYLAYV
FT                   TLLSLVPLIAVGVAIFSAFPGFESTRLAIESFLFTNFVPTSSDVIKEHISSFAGNANQM
FT                   TAVGIGFLAAIALLLIRNVDATLNRIWRIKKKRPMMISFAVYWMVLSLGPVFLGGSIAV
FT                   TSYIVSLVSFADQGIPGFSGFLLKLLPYGISMVGFIMLYTLVPNTRVSFKAAIPGALFA
FT                   AMLFELTKKGFALYISHFPSYEVIYGAVATIPILFVWIYLSWIVVLLGAELTACISPEN
FT                   IEDTPEIELDEQENTKDTL"
     atgaacgata agctctctta ttataaacag caagttggat cttttttacg gcagcaaccc        60
     ggctggtgga tgcaatatat taaccgctgt attgatgacc aaataaccgt taacgcgggc       120
     tatttagctt atgtaacttt gctgtctttg gtgccattaa ttgccgtagg tgtggcgata       180
     ttttcggctt ttccggggtt tgaatcaact cgattagcaa ttgaaagctt tttatttact       240
     aactttgtgc ctacttcgtc agatgttatt aaagagcata ttagctcgtt tgcgggcaat       300
     gcaaatcaaa tgaccgcagt gggcattggc tttttagctg ctattgcctt gttacttatt       360
     cgtaatgttg atgccacgct taaccgtatt tggcgaatta aaaaaaagcg tccaatgatg       420
     atttcgtttg ccgtttattg gatggtactt agtttagggc ccgtattttt aggcggcagt       480
     attgcagtta cttcgtatat tgtatcgttg gtgtcgtttg ctgatcaggg gattccgggg       540
     tttagtggct ttttattaaa gttattgccg tacggcattt ctatggtggg ttttattatg       600
     ctctacacct tggtgcccaa cactcgggtt tcgtttaaag cggcgatacc aggtgcacta       660
     tttgctgcca tgttgtttga gttaactaaa aaaggttttg cgctttatat tagccacttt       720
     ccatcttatg aagttattta tggtgcagtt gctaccattc ctattttgtt tgtgtggata       780
     tatttgtcgt ggatagtggt gttgctaggc gctgagctta cggcgtgtat tagccctgaa       840
     aatattgaag acacgcccga aatagagcta gacgagcaag aaaatacaaa ggatacgcta       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page