(data stored in ACNUC7421 zone)

EMBL: CR954246.RDOA

CR954246.RDOA        Location/Qualifiers
FT   CDS_pept        259246..260220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdoA"
FT                   /locus_tag="PSHAa0247"
FT                   /product="conserved hypothetical protein, putative
FT                   homoserine kinase type II"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12511488; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85350"
FT                   /db_xref="GOA:Q3ILM5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM5"
FT                   /protein_id="CAI85350.1"
FT                   /translation="MSKFSFIDLTPDLILDAIESVGIYVESGLLALNSYENRVYQFVAE
FT                   GGKRYVVKFYRPERWSEKQIQEEHDFAFELAEAEVPVVAPMEYNGQSLFEHQGYLFTLF
FT                   PSVGGRLFEVDNLDQLDVLGRLIGRMHQVAKTKPFTQRPTLTCEEYLHTAKVHLQKSNL
FT                   VPMGLETAFYTILDLVIKQAQAQYTNVKTIRLHGDCHAGNILWAGDALMFVDLDDSRQG
FT                   PPIQDLWMMLSGDRQTQLLQLDTLVTAYEEFCDFDHSQLKLIEPLRAMRIIHYMGWVAK
FT                   RWSDPAFVRNFSWFADDKYWEQQILALKEQLAALQEAPLKLLP"
     atgagtaaat ttagctttat tgatttaacc ccagatctaa ttcttgatgc catagaaagc        60
     gttggtattt atgttgagtc tggtttattg gcattaaata gttacgaaaa tagagtgtat       120
     caatttgtag ctgaaggcgg aaaacgctac gttgttaaat tttatcgtcc agagcgttgg       180
     agcgagaagc aaatacaaga agagcatgac tttgcttttg agttagcaga ggccgaagta       240
     ccggttgttg cgccaatgga atataacggg caaagcttat ttgaacacca aggctattta       300
     tttactttat ttccaagtgt tggcgggcgt ttatttgaag tcgataactt agatcaactt       360
     gatgtactag ggcgcttaat tggcagaatg catcaagttg ctaaaacaaa accatttaca       420
     caaaggccca ccctaacctg cgaagagtac ttacatacag caaaagttca tctgcaaaaa       480
     agtaacttag tacctatggg attagaaact gctttttata ccattttaga tttggttatt       540
     aagcaggcgc aagcacagta taccaatgta aaaacgatac gtttgcatgg ggattgccat       600
     gctggcaata tattatgggc aggcgatgcg ttaatgtttg ttgatttaga tgatagtcgc       660
     caggggccac ccattcagga tctatggatg atgctaagtg gcgatcgaca aacgcagctg       720
     ttacagttag ataccttagt aaccgcctat gaagaatttt gtgattttga tcactcacag       780
     cttaagttga tcgaaccact tcgggctatg cgtatcatcc attacatggg gtgggttgca       840
     aaacgatgga gcgatccggc ttttgtgcgg aacttttcat ggtttgctga tgacaaatac       900
     tgggagcaac aaattttagc acttaaagag cagcttgccg cattgcaaga agcaccgcta       960
     aaattattgc cataa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page