(data stored in ACNUC7421 zone)

EMBL: CR954246.RECF

CR954246.RECF        Location/Qualifiers
FT   CDS_pept        2675..3769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PSHAa0003"
FT                   /product="gap repair protein with nucleoside triP hydrolase
FT                   domain, part of RecFOR complex that targets RecA to
FT                   ssDNA-dsDNA junction"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585965, 12718760, 12769856; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85117"
FT                   /db_xref="GOA:Q3IDE8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDE8"
FT                   /protein_id="CAI85117.1"
FT                   /translation="MSLSHLSLKYFRNIEALTLEPVNGVNIIYGENGSGKTSLLEAIYY
FT                   LSHGKSFRTSKHKSIIAHQQEQFVIHGRKAIHDLSIPIGISKTQAGETNLKIQGKASRK
FT                   ISELAQLMPVQIITPESYSLFFGGPKERRKFLDLGLFHVEHEFFFLWQSFNKVLKQRNA
FT                   LLKSKPKNYFDQIKFWDKEFVRLAEQINKLRMAYISRFKQQFFDKMCAELTLIRDLEIS
FT                   FNAGWKESESLSDALELNFERDARQGFTSKGPHKADFSFSVAGSSVENIFSRGQLKLLL
FT                   YALKVTQNSLIESETDKQSILLIDDLPSELSEDTKEKVGQLLAHCSSQIFISSILSESI
FT                   SAVVEPMQRELQMFHVKHGNLITR"
     atgagcttaa gtcatttgag cctcaaatat tttcgtaata ttgaggcgct gacgctagaa        60
     ccagttaacg gcgttaatat aatttatggt gaaaacggca gcggaaaaac cagcctttta       120
     gaagctattt attacctttc acacggcaaa tcttttagaa catcaaagca taaaagtatt       180
     attgcgcatc agcaagagca gtttgtaatc catggccgca aagctataca cgacttatct       240
     attcctattg gtattagtaa aacccaagcg ggcgaaacga atttaaaaat tcaaggtaag       300
     gcgagccgaa aaatatcaga acttgcacag cttatgccgg tacaaataat tactccagag       360
     agttactcgt tattttttgg tgggcctaaa gagcgcagaa agtttttaga tttaggtttg       420
     ttccacgtgg aacatgagtt tttcttttta tggcaatcgt tcaataaagt gttaaaacaa       480
     cgaaatgcgc tactaaaaag taagccaaag aattattttg accaaattaa gttttgggac       540
     aaagaatttg ttagactggc tgagcaaata aataaattaa gaatggcgta tataagtagg       600
     tttaagcagc agttttttga taaaatgtgt gcagaattaa cgctaatacg cgatttagaa       660
     ataagcttta atgccggctg gaaagagagc gaatctctta gcgatgcatt agagttaaac       720
     tttgagcgag atgctcgcca aggttttact agtaaagggc ctcataaggc tgattttagt       780
     tttagtgtcg ctggcagcag cgttgagaat attttctctc gtggacaatt aaagctatta       840
     ctttatgcgt taaaagtaac gcaaaatagc ttaattgagt cagagacaga taagcaatct       900
     atattgctaa tagatgattt accttcagag ttaagcgaag atacaaaaga gaaagtgggg       960
     caactattag ctcactgcag ttctcaaatt tttatatctt caattttgtc tgaaagtatt      1020
     tctgctgtgg tggaacccat gcaacgagaa ctgcaaatgt tccacgtgaa acatggcaac      1080
     ctaataacaa gataa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page