(data stored in ACNUC7421 zone)

EMBL: CR954246.RECJ

CR954246.RECJ        Location/Qualifiers
FT   CDS_pept        529691..531412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="PSHAa0516"
FT                   /product="Single-stranded-DNA-specific exonuclease, 5'-->
FT                   3'-specific"
FT                   /function="3.1.6 : Degradation of DNA"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2649886; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85606"
FT                   /db_xref="GOA:Q3ILD9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD9"
FT                   /protein_id="CAI85606.1"
FT                   /translation="MKKTIQTRENVDDSHLPSHLHPVIKQIYATRNVSHADELNNSAAT
FT                   LHDFKLFKDMDKACDLLIEALHAQSHILIVGDFDADGATSTATLMQGLAMFGFAHLDYL
FT                   VPDRFSLGYGLSPALAAQIVQLKPDLVITVDNGISCIAGIDIVKAANIKVLVTDHHLQG
FT                   ETLPNADAIVNPNRHDCSFPSKSIAGVGVAFYLLIALRSTLREQNHFAQQPMPNLADLL
FT                   DIVALGTVADVVALDANNRTLVHQGLARIRSGKTRPGITALIEVANRNASRLSASDFGF
FT                   SLAPRLNAAGRLDDMSLGIACLLSTDINQARRIASELDSLNFARREIEQGMQHEAQAVL
FT                   DKLAFNDDNIPDAICLYQEDWHQGVIGILAGRLKEKYHRPTVIFAGGENGEIKGSCRSI
FT                   EGLHIRDLLEGLSTADPHLISKFGGHAMAAGLSINEQQFSEFKHAFDTAVSAQLSEESK
FT                   RCIVFTDGELPNECFTMDFAQQLKQAGPWGQQFPEPVFEHTFELIQQRIVGEKHLKLVL
FT                   KHQSGRLVDAIAFGIDVKEWPDNNAQFVKAAYQLDINEFRGKFTLQLIIRELEKAS"
     atgaaaaaaa cgatccaaac gcgcgaaaac gtcgatgatt cacatttacc gagtcattta        60
     caccctgtaa ttaagcaaat ttatgccacg cgaaatgttt cccatgccga tgagctaaat       120
     aacagcgccg ccacattaca cgactttaag ttatttaaag atatggacaa agcctgcgac       180
     ttgttaattg aggcgctaca tgcccaaagc catattttaa ttgttggcga ttttgatgct       240
     gatggtgcaa ccagtaccgc tacattaatg caaggcttgg ccatgtttgg ctttgctcat       300
     ttagattact tagtacctga tcggtttagc ttaggttatg gtttaagccc ggcgttagct       360
     gcgcaaatag tacagcttaa acccgattta gtaattacag tcgataacgg tatttcctgt       420
     attgcgggta ttgatattgt aaaagccgcc aatattaaag tactggttac cgaccatcac       480
     ctacagggcg aaacactccc taatgccgat gccatagtaa acccgaacag gcacgactgc       540
     agctttccgt ctaaatcgat tgcaggtgtt ggtgtggctt tttacttact tattgccctt       600
     agaagcacac tgcgtgagca aaatcatttt gcgcagcagc ctatgcctaa cttagccgac       660
     ctgctcgaca tagttgcgct tggtactgta gccgatgtag tggcgcttga tgccaataac       720
     cgaacattgg tgcaccaagg actagcgcgt attcgcagtg gtaaaactcg cccaggcatt       780
     actgccctca ttgaggttgc taatcgtaat gcctcaagat tgagtgccag cgactttggt       840
     ttttcgcttg ctccgcgctt aaatgccgca gggcgcttag atgacatgag tttaggcata       900
     gcctgcttac tcagtaccga tataaaccaa gctaggcgca ttgccagtga gctagatagc       960
     ttaaactttg cacgccgcga aatagagcaa ggcatgcagc atgaagcgca agctgtgctt      1020
     gataagttag cgtttaatga tgacaatatt cccgacgcta tttgtttata ccaagaggat      1080
     tggcaccaag gtgttatcgg tattttagcc gggcgtttaa aagaaaaata ccaccgccca      1140
     acagttatat ttgcgggtgg cgaaaacggt gagataaaag ggtcatgtcg ctcaattgaa      1200
     gggctgcaca tacgcgattt actcgaaggg ctaagtacgg ccgatccgca cttaattagt      1260
     aagtttggtg gccatgccat ggcggccggt ttaagtatta atgagcagca atttagcgaa      1320
     tttaaacacg cctttgatac tgccgttagc gcccagctta gtgaagaaag taaacgctgc      1380
     attgtattta ccgatggcga gttgccaaat gagtgtttta ccatggattt tgcccagcaa      1440
     ttaaaacaag cgggcccttg ggggcagcaa tttcctgaac cggtatttga gcacacattt      1500
     gagttaattc agcagcgtat agtgggcgaa aagcatttaa aactggtatt aaaacatcaa      1560
     tcaggccgct tagttgatgc catagctttt ggcattgatg taaaagaatg gccagataac      1620
     aacgcacaat ttgttaaagc agcgtatcag ctcgatataa atgagtttag aggcaagttc      1680
     accctgcaat taattatccg agagctagaa aaagccagct aa                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page