(data stored in ACNUC7421 zone)

EMBL: CR954246.RECX

CR954246.RECX        Location/Qualifiers
FT   CDS_pept        546352..546804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="PSHAa0531"
FT                   /product="putative regulatory protein, inhibitor of RecA
FT                   recombinase and coprotease activities"
FT                   /function="3.1.4 : DNA proof-reading and repair"
FT                   /function="3.1.2 : DNA recombination"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8165147, 12547390; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85620"
FT                   /db_xref="GOA:Q3ILF4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF4"
FT                   /protein_id="CAI85620.1"
FT                   /translation="MDDKLKQKLKNYVLWLLSRQEYSRRELTFKLQKKEATDEFIETLL
FT                   DWCEKHNFVNEQRYCEGFVRKHIFKCHGLRRIQSEAMGKGIDRSLLEKVIEELEVDWFE
FT                   LAQDAYNKKYSNTPADLEYKDKAKRVRYLMYRGFSYDEIDFAMQAQ"
     atggatgata agttaaagca gaaattaaaa aactatgtac tttggttgtt atcaaggcaa        60
     gaatattcac gccgagaatt aacgttcaaa ttacaaaaaa aagaagccac agatgagttt       120
     atcgaaacct tgcttgattg gtgcgaaaag cacaattttg taaacgagca acgttactgt       180
     gaaggctttg ttagaaaaca catatttaaa tgccatggct taaggcgcat tcaaagcgaa       240
     gctatgggca aagggattga ccgttcatta cttgaaaaag taattgaaga gcttgaagta       300
     gattggtttg agctggcgca ggatgcgtac aataaaaaat attcaaatac accggcagac       360
     ctcgaataca aagacaaggc caagcgcgtg cgctacctaa tgtatagagg ctttagctac       420
     gatgaaatcg attttgcaat gcaagcacag taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page