(data stored in ACNUC7421 zone)

EMBL: CR954246.RFFE

CR954246.RFFE        Location/Qualifiers
FT   CDS_pept        complement(485171..486241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /locus_tag="PSHAa0466"
FT                   /product="UDP-N-acetyl glucosamine-2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7559340; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85563"
FT                   /db_xref="GOA:Q3IFQ3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ3"
FT                   /protein_id="CAI85563.1"
FT                   /translation="MAPLVHALTNDSRFEAKVCVTAQHREMLDQVLELFKITPDYDLNL
FT                   MKAGQTLPEVTSRILLELTPVLKEFKPDVVLVHGDTATTFAASLAAYYEQIAVGHVEAG
FT                   LRTGNIYSPWPEEGNRKLTGSLTKYHLAPTENSKANLLKENHAAENISVTGNTVIDALL
FT                   MVKQQIENDAELSNTLASQFPMLDENKKLILVTGHRRESFGGGFERICEALAQTAKTHP
FT                   NTQILYPVHLNPNVQEPVKRILKDVDNVHLIEPQQYLPFVYLMNRAHIILTDSGGIQEE
FT                   APSLGKPVLVMRDTTERPEAVEAGTVKLVGTDVAKITAALNELLTDDAAYKTMSRAHNP
FT                   YGDGNACQRICDILAR"
     atggcgccgc tagtacatgc attaactaac gatagtcgct ttgaagctaa agtttgtgta        60
     acggcgcagc atcgtgaaat gctagaccaa gtacttgagc tgtttaaaat aacccctgac       120
     tacgatttga acctgatgaa agcgggccaa acactaccag aagtaaccag tcgtattctg       180
     ctagagttaa cgcccgtact taaagagttt aagccagatg tagtgcttgt tcatggcgat       240
     accgcgacta cttttgcagc aagtctggcg gcttattatg agcaaatcgc agtaggtcat       300
     gtcgaagcag gcttgcgtac aggtaatatt tactcaccct ggccagaaga aggtaatcgt       360
     aaattaaccg gctcacttac aaagtaccat ttagcaccca ccgaaaattc aaaagctaac       420
     ttattaaaag aaaaccacgc ggctgaaaac atatctgtaa cgggtaacac agtaattgat       480
     gcgttattaa tggttaaaca acaaattgaa aatgatgcag aattaagcaa tacactcgca       540
     tcgcaattcc caatgcttga tgaaaataaa aagcttatat tggttacagg ccatcgccgt       600
     gaaagttttg gtggtgggtt tgagcgaatt tgcgaagcat tagcgcaaac cgcaaaaact       660
     catccaaata cgcaaatact ttatcccgtg catttaaacc cgaatgtaca agagccagta       720
     aagcgcattt taaaggatgt tgataacgta catttaattg agccacaaca atacctgcca       780
     tttgtatact tgatgaatcg tgctcatatt attttaactg actcaggtgg cattcaagaa       840
     gaagcaccaa gtttaggtaa gcctgtatta gttatgcgtg ataccacaga gcgcccagag       900
     gcagttgaag caggtacagt gaaattagtt ggtaccgatg tagctaagat caccgcagca       960
     ttaaatgagt tgttaactga tgatgctgca tataaaacaa tgagtcgcgc tcacaaccct      1020
     tatggtgacg gcaatgcatg ccaacgtata tgtgatattt tagcgcgtta a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page