(data stored in ACNUC7421 zone)

EMBL: CR954246.RHLB

CR954246.RHLB        Location/Qualifiers
FT   CDS_pept        120724..121986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /locus_tag="PSHAa0114"
FT                   /product="ATP-dependent RNA helicase with nucleoside triP
FT                   hydrolase domain, putative cold-shock protein"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14981237; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85223"
FT                   /db_xref="GOA:Q3IDI9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI9"
FT                   /protein_id="CAI85223.1"
FT                   /translation="MTDKKFSDFAIAPEVVAGLTESGFEYCTPIQAKCLPFICEGRDIA
FT                   GQAQTGTGKTLAFLTATCHRLLQSSKAPSKHPRALIMAPTRELAIQIHKDAKILAPHCN
FT                   LNLGLVYGGEDYEKQRAQLEKGVDILIGTTGRLIDLYKQGCYTLNEIEVVVLDEADRMF
FT                   DLGFIKDIRYMFHRMPDTSKRLNLLFSATLSYRVQELAFEHMTNPEHVQIEPDVKTGKR
FT                   IQEELFHPSQEDKIKLLLTLIEEEWPEKAIIFANTKHSCETVYAWLKADGHRVGMLTGD
FT                   VNQKKRQSILAEFSKGDLDFLVATDVAARGLHIPEVSHVFNFDLPDDCEDYVHRIGRTA
FT                   RAGASGHAISFACEQYAYNLHEIEEYIDHSIPLSHYDKTALLDDLTKPTIHRKRNFSTG
FT                   PRNRSNNSGRRPNNSYQKGRS"
     ttgaccgata aaaagttttc agactttgct attgcaccgg aagtggttgc cggtttaacc        60
     gaaagtgggt ttgaatattg cacacccatt caagctaaat gcctaccttt tatttgtgag       120
     ggtcgcgata ttgcaggcca agcacaaaca ggtacaggca aaacgttggc gtttttaact       180
     gccacgtgcc atcggttatt acaatctagc aaagccccta gtaaacatcc aagagccctg       240
     atcatggccc ctacaaggga gctggcgatt cagatacaca aagatgcaaa aattttagcg       300
     ccgcactgta atcttaactt aggtttagta tatggtggcg aagattacga aaaacaacgt       360
     gcacaactag aaaaaggcgt tgatatttta attggtacta caggtcgttt aattgatctg       420
     tataagcaag gctgttacac ccttaatgaa attgaggtag tcgtgcttga cgaagcagat       480
     cgtatgtttg atttgggctt tatcaaagat attcgttata tgttccaccg tatgccagat       540
     acatcaaagc gtttaaattt attattctct gcaacgctat cgtatcgtgt acaagaactt       600
     gcgtttgaac atatgaccaa tcctgagcac gtacaaattg aaccagacgt aaaaaccggt       660
     aaacgcattc aagaagagct atttcatcct tcacaagaag ataaaattaa gctgctgctg       720
     acgttaattg aagaagagtg gcctgaaaaa gccattatct ttgctaacac taagcatagt       780
     tgtgaaaccg tatatgcctg gttaaaagcc gatggacatc gggttggcat gcttaccggt       840
     gacgtaaatc agaaaaaacg tcaatcaatt ttagctgagt ttagtaaagg cgacttagac       900
     tttttagtgg caacagatgt tgcagcacgt ggtctacata ttcctgaagt aagccatgta       960
     tttaattttg atttaccaga tgattgcgaa gattacgtac accgtattgg ccgtacagcc      1020
     cgcgctggcg cgtctggtca cgctattagt tttgcatgtg aacaatatgc ttataacttg      1080
     catgaaattg aagagtatat agatcacagt attcctttat cacattacga taaaacagca      1140
     ttactggatg atttaactaa acctactatt catagaaagc gtaacttttc tacaggccca      1200
     cgtaatcgca gtaacaacag cggacgtcgc ccaaataata gttatcaaaa aggacggtca      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page