(data stored in ACNUC7421 zone)

EMBL: CR954246.RIBA

CR954246.RIBA        Location/Qualifiers
FT   CDS_pept        544927..545550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="PSHAa0529"
FT                   /product="GTP cyclohydrolase II"
FT                   /function="2.5.8 : Riboflavin, FMN, and FAD"
FT                   /EC_number="3.5.4.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8320220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0529"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85618"
FT                   /db_xref="GOA:Q3IJ00"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ00"
FT                   /protein_id="CAI85618.1"
FT                   /translation="MAQVRARVQLNVGKNSDIPAEIISFTDLKDGKEHIAMVFNNADTE
FT                   QDVPLIRMHSECLTGDVFYSSRCDCGEQLNECIEMMHEQGGILLYLRQEGRGIGLYNKI
FT                   DAYVLQSQGMNTYEANNHLGFADDLRDFSDAVLMLNALNLPHVKLMTNNPKKLNALRDA
FT                   GITVDSVVGTHAHIKAGVAGNKAYLETKIKHGAHMLDIKKIKKP"
     gtggcgcaag taagagcaag agttcagctt aatgttggca agaacagtga tattcccgct        60
     gaaattatct cgtttactga tttaaaagat ggcaaagaac atattgctat ggtgtttaac       120
     aacgctgata cagagcaaga tgtaccgctt attcgtatgc attcagagtg tttaacgggt       180
     gatgtatttt actcgtcgcg ttgtgattgc ggtgagcagt taaatgagtg tattgaaatg       240
     atgcacgagc aaggcggtat tttattgtat ttacgccaag aaggtcgtgg tattggtttg       300
     tataataaaa tagatgctta cgtgttgcag tcgcaaggta tgaacactta tgaggcaaat       360
     aatcatttag gttttgccga tgatttacgt gatttttcgg atgcggtgct aatgctaaat       420
     gcgcttaatt taccccacgt taaattaatg accaataacc ctaaaaagct taatgcacta       480
     agagatgctg gtattacggt tgattcggtt gtgggtacgc acgcacacat taaagccggt       540
     gttgcgggta ataaagcgta tttagaaacc aaaattaaac atggcgcgca catgttagat       600
     atcaaaaaaa ttaaaaaacc ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page