(data stored in ACNUC7421 zone)

EMBL: CR954246.RNK

CR954246.RNK         Location/Qualifiers
FT   CDS_pept        complement(272118..272603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="PSHAa0258"
FT                   /product="putative regulator of nucleoside diphosphate
FT                   kinase"
FT                   /function="2.3.3 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7565093; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85357"
FT                   /db_xref="GOA:Q3IDT1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT1"
FT                   /protein_id="CAI85357.1"
FT                   /translation="MQLSLCRIILRVSFIYINIIKDIELNKRPEIIISSLDADRLYDLI
FT                   ESLPANSFAGEKELEAELGRATIVDPKDVPATIVTMNSTVNFVVESSKEEFNLTLVYPK
FT                   DLDASGQKISILAPIGGALLGLSQGDEIEWPKPGGGLIKVKIKEVTYQPERVGELHR"
     gtgcaattaa gcttatgccg aatcatactc agagtaagtt ttatttacat aaacattatt        60
     aaggatattg agttgaataa aagacctgaa ataatcatct catcattaga tgcagataga       120
     ctatatgatt taatcgaatc attgccagca aacagttttg cgggtgaaaa agaactggaa       180
     gcagaattag ggcgagcaac tatagttgat cctaaagacg ttccagcaac aatagttacc       240
     atgaattcga ccgtaaattt tgttgtagaa tcttcaaaag aagaatttaa tttaactctt       300
     gtctacccga aagatcttga cgctagcggc caaaaaatat caattttagc ccctatagga       360
     ggcgctttac ttgggctatc acaaggagat gaaattgaat ggcctaagcc tggtggaggt       420
     ttaataaaag taaaaataaa agaagtaacc taccaacctg aaagagtcgg cgaactacat       480
     agataa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page