(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLA

CR954246.RPLA        Location/Qualifiers
FT   CDS_pept        226109..226813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PSHAa0219"
FT                   /product="50S ribosomal subunit protein L1"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 365581, 7556101, 3298242; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85322"
FT                   /db_xref="GOA:Q3ILQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ3"
FT                   /protein_id="CAI85322.1"
FT                   /translation="MAKLTKRMRTIREKVEVTKDYEINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTQGANAEAAKEAGAELVGMEDLAELV
FT                   KKGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFTAEQLQQNLESLIVALKKAKPSQAKGVYVKKVSISTTMGAGV
FT                   AVDQNTLSTTVA"
     atggctaaat taactaaacg tatgcgtact atccgcgaaa aagtggaagt aactaaagat        60
     tacgaaatca acgaagcgat cgcgctttta aaagagttag cgacagctaa gtttgtagaa       120
     agtgttgacg ttgctgttaa ccttggtatc gatgctcgta aatctgatca aaacgttcgt       180
     ggtgcaactg tactacctaa cggtactggt cgtgacgttc gcgttgcagt attcacacaa       240
     ggcgctaacg cagaagctgc gaaagaagcc ggtgctgaat tagtaggtat ggaagatctt       300
     gctgagctag ttaaaaaagg cgagatgaac tttgacgttg ttgttgcatc accagacgct       360
     atgcgtgttg ttggtcaact aggtcaaatc ttaggcccac gtggtctaat gccaaaccct       420
     aagactggta cagtaacacc taacgttgct gaagcagtta aaaatgcaaa agcgggtcaa       480
     gtacgttacc gtaatgacaa aaatggcatc atccatacta ctattggtaa ggttgatttc       540
     actgctgagc aattacaaca aaaccttgag tcactaattg ttgcgcttaa gaaggctaaa       600
     ccttctcaag ctaaaggtgt ttacgtgaag aaagtaagca tctctacaac aatgggcgca       660
     ggcgttgctg ttgaccaaaa cacgttaagc acaactgtag cttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page