(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLB

CR954246.RPLB        Location/Qualifiers
FT   CDS_pept        158157..158981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="PSHAa0147"
FT                   /product="50S ribosomal protein L2"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 7556101, 3298242, 11013226; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85251"
FT                   /db_xref="GOA:Q3IF22"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF22"
FT                   /protein_id="CAI85251.1"
FT                   /translation="MALQKCKPTSAGRRHLVKVVNSDLHKGKPYAPLLEKNSKSGGRNN
FT                   NGRITVRHIGGGHKQHYRLIDFKRTKDGIPATVERLEYDPNRSANIALVLYADGERRYI
FT                   IAPKGLKAGDAIQSGVDAPIKPGNALPMRNMPVGSTVHNVELKPGKGAQIARSAGAYVQ
FT                   ILARDGQYVTLRLRSGEVRKVEADCRATLGEVGNAEHMLRSLGKAGANRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGAKTRKNKRTDKFIVRRRTK"
     atggcacttc aaaagtgtaa gcctacttct gcgggccgtc gtcacttagt taaagtggtt        60
     aactctgatt tacataaggg taagccgtac gcaccactat tagagaaaaa ctctaaatca       120
     ggtggtcgta ataacaatgg tcgtattacg gttcgtcata tcggtggtgg tcataagcaa       180
     cattaccgtt taatcgattt taaacgtact aaagatggca ttccagccac tgttgaacgt       240
     ttagaatacg atccaaatcg tagcgcaaac atcgctcttg tattatatgc agacggtgag       300
     cgtcgttaca ttatcgcacc aaaaggctta aaagctggcg atgcaatcca gtctggtgtt       360
     gatgcaccaa tcaaacctgg taatgcatta ccaatgcgta atatgcctgt aggttcgact       420
     gttcacaacg tagaattaaa accaggtaaa ggtgctcaaa tcgcacgttc tgctggtgca       480
     tacgttcaaa tccttgctcg tgatggtcag tatgtaacat tacgtcttcg ttcaggcgaa       540
     gtacgtaaag ttgaagctga ttgtcgtgcg actctaggtg aagtaggcaa tgctgagcat       600
     atgcttcgtt cacttggtaa agcaggtgca aatcgctggc gtggtatccg tccgacagtt       660
     cgtggtgttg ccatgaaccc ggtagatcac ccacacggtg gtggtgaagg tcgtacatct       720
     ggtggtcgtc atcctgtgtc tccatggggt aagccgacta aaggtgctaa gacacgtaag       780
     aacaagcgta ctgataagtt tatcgtacgt cgtcgtacta aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page