(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLC

CR954246.RPLC        Location/Qualifiers
FT   CDS_pept        156584..157219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="PSHAa0144"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9813114, 11847124; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85248"
FT                   /db_xref="GOA:Q3IF25"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF25"
FT                   /protein_id="CAI85248.1"
FT                   /translation="MALGLVGRKVGMTRIFTEDGVSIPVTVIEATPNRIAQIKSEATDG
FT                   YNALQVTAGTKKASRVNKASAGHFAKAGVEAGRGLWEFRLNGGEGDFEVGAELTVELFN
FT                   EINKVDVTGTSKGKGFQGGVKRWNFSMQDATHGNSLSHRAPGSIGQNQSPGKVFKGKKM
FT                   AGHMGAERVTTQNLELVRVDAERNLLLVKGAVPGAIGGDVIVKPAVKA"
     atggcattag gtctagtcgg tcgtaaagtg ggtatgacac gaatcttcac tgaagatggt        60
     gtatctatcc ctgtgacagt tattgaagcg acacctaacc gcattgctca gattaaatct       120
     gaagcaacag acggttataa cgcgcttcaa gtaaccgcag gcactaaaaa agcaagtcgt       180
     gtaaacaaag cttcagcggg tcatttcgct aaagctggtg ttgaagcggg tcgcggtctg       240
     tgggaattcc gcctaaatgg tggtgaaggc gattttgaag taggcgctga gcttactgtt       300
     gaattattca acgaaatcaa caaggttgac gtaaccggta cttctaaagg taaaggtttc       360
     caaggtggtg ttaagcgctg gaatttcagc atgcaagacg ctacacatgg taactctcta       420
     tctcaccgtg ctcctggttc aatcggtcaa aaccaatcac ctggtaaggt gtttaaaggt       480
     aagaaaatgg ccggtcatat gggtgctgag cgtgtaacga ctcaaaactt agaactagtt       540
     cgcgttgacg ctgagcgtaa tttgctttta gttaaaggtg cagtacctgg cgctatcggc       600
     ggtgacgtta tcgttaaacc agctgttaaa gcataa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page