(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLD

CR954246.RPLD        Location/Qualifiers
FT   CDS_pept        157237..157842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="PSHAa0145"
FT                   /product="50S ribosomal subunit protein L4"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85249"
FT                   /db_xref="GOA:Q3IF24"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF24"
FT                   /protein_id="CAI85249.1"
FT                   /translation="MELAIKDASGGLEVSEATFGREFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRSEVSGGGKKPWAQKGTGRARAGTIRSPIWRSGGVSFAAKPQDHSQKVNRKMYRGA
FT                   IKSILSELVRQERLIVVESFALAAPKTKELVAKLKELELKDVLIVTEEVDENLFLSARN
FT                   LYKVDTRDVAGIDPVSLIAFDKVLITAAAVKQLEEALA"
     atggaattag caattaaaga cgcttctggc ggtcttgaag tttctgaagc tacttttgga        60
     cgtgagttta acgaagcatt agtacatcaa gtagttgttg catacgcagc aggtgctcgt       120
     caaggtactc gtgctcagaa gacacgttct gaagtaagcg gtggtggtaa aaagccatgg       180
     gctcaaaaag gtactggccg agcacgtgct ggtacgattc gtagcccaat ttggcgttca       240
     ggtggcgtta gctttgcagc taaaccacag gatcatagcc aaaaagtaaa ccgtaaaatg       300
     taccgcggtg cgattaaaag catcttatct gaattagttc gtcaagagcg tttaatcgtt       360
     gttgaaagtt ttgctctagc agcaccaaaa actaaagaac tagttgctaa gcttaaagaa       420
     cttgagctta aagatgttct tatcgtgact gaagaagtag atgaaaatct tttcttatcg       480
     gcacgtaacc tttataaggt tgacacgcgt gatgtagctg gtatcgatcc tgtaagctta       540
     attgctttcg acaaggtact tattacagcc gctgctgtta agcaacttga ggaggcgcta       600
     gcatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page