(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLJ

CR954246.RPLJ        Location/Qualifiers
FT   CDS_pept        227136..227630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PSHAa0220"
FT                   /product="50S ribosomal protein L10"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 377281, 782920, 2448482; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85323"
FT                   /db_xref="GOA:Q3ILQ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ2"
FT                   /protein_id="CAI85323.1"
FT                   /translation="MALNLQGKQAIVAEVNEAANGALSAVVADSRGVTVGAITALRKEA
FT                   RANGVWMKVVRNTLAKRALEGTQFECLSDSFVGPSLIAFSSEHPGAAARIFSAFAKKNE
FT                   KFELKTAAFEGNVVDAAMLATLPTYDEAVARLMSAMKEASAGKLCKTIEAVRVQKEEQA
FT                   A"
     atggctttaa atcttcaagg caaacaagca atagttgctg aagtcaacga agcagccaat        60
     ggtgctctat ctgcagttgt tgcagattct cgtggtgtaa cagttggcgc aatcactgcc       120
     cttcgtaaag aagctcgtgc aaatggtgtt tggatgaaag ttgtccgtaa cactttagca       180
     aaacgtgctc ttgaaggaac acagtttgag tgcctttctg attcatttgt tggtccaagc       240
     ttaatcgctt tctcatcaga gcacccaggt gctgctgcgc gtatcttttc tgcttttgca       300
     aaaaagaacg agaaatttga gcttaaaacg gccgcttttg aaggaaatgt tgttgatgca       360
     gcaatgcttg ctacattacc tacatacgac gaagctgttg cacgcttaat gagcgctatg       420
     aaagaagcgt ctgctggtaa attgtgtaaa acaattgaag cagtacgtgt acagaaagaa       480
     gagcaagctg cttaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page