(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLK

CR954246.RPLK        Location/Qualifiers
FT   CDS_pept        225676..226104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PSHAa0218"
FT                   /product="50S ribosomal subunit protein L11"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11244072, 11673421; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85321"
FT                   /db_xref="GOA:Q3ILQ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ4"
FT                   /protein_id="CAI85321.1"
FT                   /translation="MAKKVEALIKLQVNAGMANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TESIEKGAPVPVVISVYGDRSFTFDMKTPPAAYLLLKAAGVKSGSGRPNTEKVGTVTRA
FT                   QLEEIVETKRADLTASDLEAAVRTIAGSARAMGLSVED"
     atggctaaaa aagttgaagc tctaatcaag ctacaagtta atgctggtat ggctaatcct        60
     agtccaccag taggtcctgc actaggtcaa cacggtgtaa acatcatgga attctgtaaa       120
     gcgtttaacg cacgtacaga gtctatcgaa aaaggcgctc cagttcctgt agtgatctct       180
     gtttacggtg accgttcttt tacgttcgac atgaaaactc cacctgcagc atacttgcta       240
     cttaaagcag ctggcgttaa atcaggctca ggccgtccta acactgaaaa agtaggcaca       300
     gtaactcgtg ctcaacttga agagattgtt gagactaaac gagctgacct tacagcttct       360
     gatttagaag ctgcggttcg cactatcgca ggatctgctc gtgcgatggg cttgagcgta       420
     gaggactaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page