(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLL

CR954246.RPLL        Location/Qualifiers
FT   CDS_pept        227705..228067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PSHAa0221"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2660100, 168924, 8234320, 10747797; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85324"
FT                   /db_xref="GOA:Q3ILQ0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ0"
FT                   /protein_id="CAI85324.1"
FT                   /translation="MSVSKDQILDAIAEMSVMDVVALIEAMEEKFGVTAAAGMVAGPAA
FT                   EAVEEKTEFDVILTGAGANKVSAIKAVRSATGLGLKEAKALVEAAPTPVKEGISKEEAE
FT                   ALAKDLTEAGAEVEVK"
     atgtctgtat ctaaagacca aatccttgac gcaattgctg aaatgtcagt aatggacgtt        60
     gttgctctta tcgaagcaat ggaagaaaaa ttcggcgtaa ctgctgctgc tggtatggta       120
     gctggtccag ctgctgaagc agttgaagaa aagactgaat ttgatgtaat ccttactggc       180
     gctggcgcta acaaggtttc tgcaatcaaa gcagttcgta gcgcaactgg cctaggcctt       240
     aaagaagcga aagctcttgt tgaagctgca ccaacacctg ttaaagaagg tatctctaag       300
     gaagaagctg aagctcttgc taaagacctt actgaagctg gtgctgaagt tgaggttaag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page