(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLP

CR954246.RPLP        Location/Qualifiers
FT   CDS_pept        160348..160761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="PSHAa0151"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85255"
FT                   /db_xref="GOA:Q3IF18"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF18"
FT                   /protein_id="CAI85255.1"
FT                   /translation="MLQPKRTKFRKTHKGRNRGLAQNGNKVSFGTFGLKATGRGRMTAR
FT                   QIEAARRAMTRHVKRQGKIWIRVFPDKPITNKPLEVRMGKGKGSVEYWVAEIQPGKVLY
FT                   EMEGVSEELAREAFDLAARKLPFKTTFVTRTVM"
     atgttacagc caaaacgtac aaaattccgt aaaacgcaca aaggtcgcaa ccgtggtcta        60
     gcgcaaaacg gtaacaaagt aagcttcggt actttcggtt tgaaagctac tggccgtggc       120
     cgcatgactg ctcgtcaaat cgaagcagct cgtcgtgcca tgacgcgtca cgtgaaacgt       180
     caaggtaaaa tctggatccg tgttttccca gacaagccaa tcacgaacaa accgcttgaa       240
     gttcgtatgg gtaaaggtaa aggttctgtt gagtattggg ttgctgaaat tcagcctggt       300
     aaagtacttt acgaaatgga aggtgtttca gaagagcttg ctcgtgaagc gtttgacctt       360
     gctgctcgta aattgccatt caaaacaact ttcgtaactc ggacggtaat gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page