(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLV

CR954246.RPLV        Location/Qualifiers
FT   CDS_pept        159289..159621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="PSHAa0149"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11468402, 13130133; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85253"
FT                   /db_xref="GOA:Q3IF20"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF20"
FT                   /protein_id="CAI85253.1"
FT                   /translation="MQALAKHKFASGSAQKARLVADQIRGLPVDRALEILAYSPKKAAV
FT                   LVKKVLESAIANAEHNEGADIDELRITTIFVDDGPTMKRIMPRAKGRADRILKRTSHIT
FT                   VMVSDS"
     atgcaagcat tagctaaaca taaattcgcc tctggttcgg cgcaaaaagc acgtctagtt        60
     gcagatcaga tccgcggact accggttgat cgcgcactag aaatcctggc gtacagcccg       120
     aaaaaagcgg ctgtattagt aaagaaagta cttgagtctg ctattgctaa cgcagagcat       180
     aacgaaggtg ctgacattga tgagcttcgt ataacaacga tctttgtgga cgatggtcct       240
     acaatgaaac gtattatgcc acgtgctaaa ggacgcgcag accgcatcct taagcgtaca       300
     agccatatca ctgttatggt ttcagatagc tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page