(data stored in ACNUC7421 zone)

EMBL: CR954246.RPLW

CR954246.RPLW        Location/Qualifiers
FT   CDS_pept        157839..158141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="PSHAa0146"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1960726, 12756233; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85250"
FT                   /db_xref="GOA:Q3IF23"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF23"
FT                   /protein_id="CAI85250.1"
FT                   /translation="MIREERLLKVIVAPHISEKSTIAAEENNTIVFKVAKDSTKAEVKA
FT                   AVEKLFEVEVTGVRTLNVKGKTKRTGARFGRRNDWKKAYVTLKEGSELDFVGGAE"
     atgattcgcg aagaacgtct tttaaaagtg atcgttgctc cacatatctc tgaaaaaagc        60
     actattgctg ctgaagaaaa caatactatt gtttttaaag tagcaaaaga ttcaactaaa       120
     gctgaagtta aagcagcagt tgagaagctt tttgaagtag aagtaacggg tgttcgcaca       180
     cttaacgtta agggtaaaac aaaacgtact ggcgcacgtt tcggtcgtcg taacgactgg       240
     aaaaaagctt acgttactct taaagaaggt agcgagctag actttgtcgg cggcgccgag       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page