(data stored in ACNUC7421 zone)

EMBL: CR954246.RPMC

CR954246.RPMC        Location/Qualifiers
FT   CDS_pept        160761..160952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="PSHAa0152"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85256"
FT                   /db_xref="GOA:Q3IFM4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM4"
FT                   /protein_id="CAI85256.1"
FT                   /translation="MKASELKDKSVEELNTELLGLLREQFNMRMQASTGQLAQTHTLRT
FT                   VRRDIARVKTVINQKAGQ"
     atgaaagcta gcgaactaaa agataaaagc gtagaagagc ttaatactga acttctagga        60
     cttcttcgtg agcaatttaa tatgcgcatg caagcaagca ctggtcagtt agctcagaca       120
     cacacgctaa gaacagtacg ccgcgatatc gcgcgtgtaa aaacagttat taaccagaag       180
     gcaggtcaat aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page