(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOB

CR954246.RPOB        Location/Qualifiers
FT   CDS_pept        228338..232363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PSHAa0222"
FT                   /product="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase beta
FT                   subunit)"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6266829; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85325"
FT                   /db_xref="GOA:Q3ILP9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP9"
FT                   /protein_id="CAI85325.1"
FT                   /translation="MAYSYSEKKRIRKDFGKRPQVLDIPFLLSTQLKSFKKFLVPDADG
FT                   DHGLEAAFRSVFPIKSYSGNSELQYVSYRIGEPVFDVKECQIRGVTYSAPLRVKLRLVV
FT                   MDKEAPGTVKDIKEQEVYMGEIPLMTDTGTFVINGTERVIVSQLHRSPGVFFDNDRGKT
FT                   HSSGKVLYNARVIPYRGSWLDFEFDAKDNLYVRIDRRRKLPASIILRALEYSSEDILGI
FT                   FFDNTTFEVTDGKVLMELVPSRLRGETAAFDIKSEDGEVFVESGRRVTARHIKNIEKKG
FT                   IKQLEVPHEYIIGRVLAKNYVDESTGEVVANANDELTLELMAELVKAGHTKIDTLYINE
FT                   VDSGAYMSNTLNIDSSSSRLEALVEIYRMMRPGEPPTKDAAEALFQNLFFSEERYDLST
FT                   VGRMKFNSRVGYDTDTGPGTLSKEDIVSVMKVLIAIRNGVGDVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVRERLSLGDLDAIMPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRVCPIETPEGPNIGLINSLS
FT                   TYARTNDYGFLETPYRKVVDGVVTDEVDYLSAIEEGQFVIAQANSNLTETNEFVDELIP
FT                   CRHKGESTFMGRMDQQYMDVSPQQVISVAAALIPFLEHDDANRALMGSNMQRQAVPTLK
FT                   ADKPLVGTGIELTLAKDSGVTIVAKRGGEVMYCDASRIVVNVHEEERVPGEAGIDIYNL
FT                   TKYTRSNQNTCINQKPTCMVGEPVTRGDVLADGPSTDLGDLALGQNLRVAFMPWNGYNF
FT                   EDSILLSERVVEEDRLTTIHIQELQCIARDTKLGSEEITADIPNVGESALGKLDESGVV
FT                   YIGAEVKSGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNSVTGTVID
FT                   VQVFTRDGVEKDKRALEVEEMQLRDAKKDFNEEFRILEAGVLDRARKLLIAAGFDEDKL
FT                   ALLNAEKLLTQSLAEEDKQAELEQLAAQYDELKAEYDKKFENKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRCIQPGDKMAGRHGNKGVISTIVPVEDMPYDDKGRTVDIVLNPLGVPSRM
FT                   NIGQILETHMGLAARGIGERIEEMMKEQRELHELRAFIKQAYEIGESRQVVDIDSFTDD
FT                   EIRRLAENLKGGLPIATPAFDGAKENEIKDMLELAGYPRSGQVTLYDGRTGDQFERQVT
FT                   VGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAY
FT                   TLQEMLTVKSDDVNGRTKMYKNIVDGNHKMEPGMPESFNVLLKEIRSLGINIELEEN"
     atggcttact cttattctga aaagaaacgt atccgtaagg attttggtaa acgtccacaa        60
     gttttggata tacctttctt actatctaca cagttaaaat cgtttaaaaa attcttagtg       120
     cctgacgctg atggcgatca tggtttggaa gcagcgttcc gttctgtgtt cccaattaag       180
     agctactcag gaaattctga gctgcaatac gtaagttatc gtattggcga gccagttttc       240
     gatgtaaaag aatgtcaaat tcgcggtgtg acttattctg ctccacttcg cgtgaaattg       300
     cgtcttgtag ttatggacaa agaagctcca ggcacagtta aagacattaa agagcaagaa       360
     gtttacatgg gcgaaattcc gctcatgacc gataccggta cctttgtaat caatggtaca       420
     gagcgtgtta tcgtttctca gctacaccgt agccctggtg tattctttga taacgaccgc       480
     ggtaaaactc actcatcggg taaagtgtta tataacgcac gtgttatccc atatcgtggt       540
     tcatggttag actttgaatt tgatgcaaaa gataacttat atgtacgtat tgaccgtcgt       600
     cgtaaattac cggcgtctat tatcttacgt gcacttgagt actcgagtga agacattctt       660
     ggtattttct tcgacaacac tacgtttgaa gtaactgacg gtaaagttct tatggaactg       720
     gtaccttcac gtttacgtgg tgaaaccgcc gcttttgata ttaagagcga agacggtgaa       780
     gtgtttgttg aaagtggtcg tcgtgttacg gctcgccata tcaagaacat cgagaaaaaa       840
     ggcattaagc aattagaagt accacatgag tacatcattg gtcgcgtatt agcgaaaaac       900
     tatgttgatg agtcaacagg tgaagttgta gctaatgcaa atgacgagct aacgcttgaa       960
     ttaatggctg aattggttaa agccggtcac actaaaattg atacgttata tatcaatgaa      1020
     gtggacagcg gtgcttacat gtcaaataca ttgaacattg actcttcaag cagccgttta      1080
     gaagcattag tagaaattta tcgcatgatg cgcccaggcg agccaccgac gaaagacgcg      1140
     gctgaagcct tattccagaa cttgttcttc tcagaagagc gctatgacct atcaactgta      1200
     ggtcgtatga agttcaatag ccgtgttggt tacgataccg atacaggccc aggcacatta      1260
     agcaaagaag acatcgtgtc ggttatgaaa gtattgattg ctattcgtaa cggtgttggc      1320
     gatgtagatg atattgacca cttaggcaac cgtcgtatac gtagtgttgg cgaaatggct      1380
     gagaatcaat tccgtgtagg tttagtgcgt gtagaacgtg ctgtacgtga gcgtttaagc      1440
     ttaggtgacc tagatgcgat aatgccacaa gatcttatta acgctaagcc tatttcggca      1500
     gcggttaaag agttcttcgg ctcgtctcag ttatcacagt tcatggacca aaataacccg      1560
     ctatcagaag taacgcataa acgtcgtatt tctgcattag ggccgggcgg tctaactcgt      1620
     gagcgcgcag gctttgaagt acgtgacgtt cacgtaactc actatggtcg cgtatgtcca      1680
     atcgagactc ctgagggtcc aaacatcggt ctaattaact cattatctac gtacgcacgt      1740
     actaatgatt atggtttctt agaaacacct taccgcaaag tggtagacgg tgttgtaact      1800
     gatgaagttg attacctatc agccattgaa gaaggtcagt ttgttatcgc acaggcgaac      1860
     tcaaacttaa ccgaaaccaa tgagtttgta gatgaactta ttccatgtcg tcacaaaggt      1920
     gaatctacct ttatgggacg tatggaccag caatatatgg atgtatcacc acaacaggtg      1980
     atctctgtag cggcagcact tatcccgttc ctagaacacg atgatgctaa ccgtgcattg      2040
     atgggttcaa acatgcaacg tcaagcagta ccaacattga aagcggataa gccgttagta      2100
     ggtactggta ttgagttaac actagcgaaa gactctggtg ttactatcgt tgcaaaacgt      2160
     ggtggtgaag taatgtattg tgacgcaagt cgcatcgttg ttaatgtaca tgaagaagaa      2220
     cgcgttccag gcgaagcggg catcgacatt tacaacttaa ccaaatacac acgttctaac      2280
     caaaatacat gtattaacca aaaaccaact tgtatggttg gcgaaccggt tactcgtggc      2340
     gatgtgttag cagatggtcc ttcgactgac ttgggcgact tagctcttgg tcaaaacttg      2400
     cgcgtggcat ttatgccatg gaatggttat aacttcgagg attcaatctt actatcagag      2460
     cgcgtagttg aagaagatcg tctaacgact atccacattc aagaactaca gtgtattgcc      2520
     cgtgatacta aattaggttc tgaagagatc actgcagata tcccgaatgt gggcgaatct      2580
     gcactaggca agcttgatga atcaggcgtt gtttatattg gtgctgaagt taaaagcggc      2640
     gatattctag taggtaaagt gactccgaaa ggcgaaacgc aattaactcc tgaagagaag      2700
     ctactacgag ctatcttcgg cgaaaaagcg tctgacgtta aagacagctc tttacgtgta      2760
     ccaaattctg taactggtac tgtaattgac gtgcaagttt tcacccgtga tggtgttgaa      2820
     aaagataagc gtgcgttaga agttgaagaa atgcagcttc gcgatgcgaa gaaagacttc      2880
     aacgaagagt tccgtattct agaagctggt gtattagacc gtgcgcgtaa gttacttatc      2940
     gcagctggct ttgatgaaga caaattagcg ttattaaatg ctgagaagct acttacgcaa      3000
     agccttgctg aagaagacaa gcaagctgag cttgagcaat tagcagccca gtatgacgag      3060
     cttaaagctg aatacgataa gaagtttgaa aacaaacgtc gtaaaatcac tcaaggcgat      3120
     gacctagcac ctggcgtact taagattgtt aaagtatacc tagctgttaa acgttgtatc      3180
     caaccgggtg ataaaatggc gggtcgtcat ggtaacaaag gtgttatctc gactatcgta      3240
     ccagtagaag atatgccata cgatgataaa ggtcgtacgg tagatatcgt acttaaccca      3300
     ctgggtgtac catcacgtat gaacatcggt cagatccttg aaacacatat gggtctagct      3360
     gcacgtggta ttggtgaacg cattgaagaa atgatgaaag agcaacgtga gctgcatgag      3420
     ttacgcgcct tcatcaagca agcctacgaa attggcgaat ctcgtcaagt agtagacatt      3480
     gatagcttta cagatgacga aattcgtcgt ttggctgaaa acttaaaagg tggtttacca      3540
     atagctactc cagcatttga tggcgcgaaa gaaaacgaaa tcaaagacat gctagagctt      3600
     gcgggctacc caagaagtgg tcaggttaca ctttatgatg gccgtactgg cgatcagttc      3660
     gaacgtcaag taaccgttgg ttacatgtac atgctgaaac tgaatcactt agttgatgac      3720
     aaaatgcatg cgcgttctac tggttcttat agccttgtta ctcagcagcc gctgggtggt      3780
     aaagcacagt tcggtggcca gcgttttggt gagatggaag tatgggcact tgaagcttac      3840
     ggtgctgctt acactctaca agaaatgcta acagtgaaat cggatgacgt gaacggtcgt      3900
     actaagatgt ataaaaacat cgttgatggt aaccataaaa tggaaccagg tatgccagaa      3960
     tcgtttaacg tattgttaaa agaaatccgc tcactgggta tcaacatcga gttggaagaa      4020
     aattaa                                                                 4026
//

If you have problems or comments...

PBIL Back to PBIL home page