(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOC

CR954246.RPOC        Location/Qualifiers
FT   CDS_pept        232468..236640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PSHAa0223"
FT                   /product="RNA polymerase, beta prime subunit"
FT                   /function="3.2.1.3.1 : RNA polymerase (core enzyme)"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6287430, 6278450; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85326"
FT                   /db_xref="GOA:Q3ILP8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP8"
FT                   /protein_id="CAI85326.1"
FT                   /translation="MKDLLKFLKQQNKTEEFDAIRIGLASPDMVRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTLTKVRRDRMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESFVVTEPGMTTLERGQLLGEE
FT                   EYLDALEEHGDEFEAKMGAEAVLDLLRELDLAQLIAEMREELPTINSETKRKKITKRLK
FT                   LMESFHQSGNNPEWMIMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLKLHQCGLPKKMALELFKPFIYGKLERRGMATTIKAAKK
FT                   MVEREMPEVWDVLDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIHLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTIEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDR
FT                   INAKGEGAIFKDPKEAEKAYRSGNADLHAIVKVRISQSVKNENGVVEDTITVIDTTVGR
FT                   AILSLILPKGMPYESINQPLGKKQISGLINECYRRLGLKDTVMFADQIMYTGFHYAMKS
FT                   GVSIGIDDLVIPPVKAQIIESAEAEVTEINQQFQSGLVTAGEKYNKVIDIWSRVNENLS
FT                   REMMSNLSKDTVINAQGEEVEQASFNSVFMMADSGARGSAAQIRQLAGMRGLMARPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVINED
FT                   DCGTEDGLTMKPLIEGGDVVEALRERVLGRVVAEDIVIPGTNTVLVERNIMLDEKLCDL
FT                   LEEHSVDEVRVRSVITCDNDFGVCANCYGRDLARGHIINAGESVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRASAENNVQVKTNGTLKLHNAKYVLNTDGKIAIISRSTEITIIDSYG
FT                   REKERYKVPYGAVLTVQDNAEVQGNDIVATWDPHSHPIVLEHKSKVSFSDIDDSNTETQ
FT                   TDELTGLTRIVVKDLSKANAKEPKLIIESEERGLQETRLPSFTTIEVVDGTTVNPGDVL
FT                   ARIPQEGSKTRDITGGLPRVADLFEARKPKEPAILAEVTGTISFGKETKGKKRLVITPD
FT                   EGDHYEEMIPKWRQLNVFEGERVSKGEVIADGPESPHDILRLRGVTHVANYIVNEVQEV
FT                   YRLQGVKINDKHIETIIRQMLRKCTIMHGGDTDFLAGEQIEVARVNIANRDLEAQGKIP
FT                   AKFEIQLMGITKASLATESFISAASFQETTRVLTDAAVNGKSDELRGLKENVIVGRLIP
FT                   AGTGFSYHQERMARRKQRNVVEEQTVSAEEATQALTDALNADLSGNQ"
     gtgaaagact tacttaagtt tctgaagcaa caaaataaga ccgaagaatt cgatgcaatt        60
     cgcattggtc ttgcttcacc agacatggtt cgttcgtggt catacggtga agtaaagaaa       120
     cctgagacta ttaactaccg tactttcaag cctgagcgcg atggcttatt ctgtgcccgt       180
     attttcggcc cagtgaaaga ttatgaatgc ttatgtggta aatataagcg tcttaaacac       240
     cgcggtgtga tctgtgagaa gtgtggcgtt gaagttacac tcactaaagt gcgacgcgat       300
     cgtatgggtc atattgacct tgcgagccca gttgcgcata tttggttttt aaaatcatta       360
     ccgtcacgta tcggcttaat gctagatatg acgcttcgtg atattgaacg tgttctttac       420
     ttcgaatcat tcgtagtaac tgagcctggt atgacaacgc ttgagcgtgg tcagctatta       480
     ggtgaagaag aatacttaga tgcacttgaa gagcatggtg atgaatttga agctaagatg       540
     ggtgctgaag cagttttaga cttgcttcgt gaactcgatc ttgcacaatt aattgctgaa       600
     atgcgtgaag agttaccaac aattaactct gaaactaagc gtaaaaaaat caccaaacgt       660
     cttaagttaa tggaatcgtt ccaccaatca ggtaacaacc ctgagtggat gatcatgaca       720
     gtacttccag tattgccacc tgatctacgc ccattagtac cactagacgg tggtcgtttt       780
     gcgacgtctg atctaaatga cctttaccgt cgtgttatta accgtaataa ccgtcttaag       840
     cgtctattag atttagcagc accagatatt atcgtacgca acgaaaaacg tatgttacaa       900
     gaagcggtag atgcgctact tgataacggt cgtcgtggtc gtgcaattac aggttctaac       960
     aaacgtcctc ttaaatctct tgccgatatg atcaagggta agcaaggtcg tttccgtcag      1020
     aacttacttg gtaagcgtgt agattattca ggccgttctg taattacagt gggtcctaca      1080
     cttaagcttc accaatgtgg tcttcctaag aagatggcac ttgagctatt caaaccattt      1140
     atctatggca aattagagcg tcgcggcatg gctacgacaa tcaaagctgc gaagaagatg      1200
     gttgaacgtg aaatgccgga agtatgggat gtgcttgacg aagtaattcg tgaacatcca      1260
     gtattactta accgtgcacc aacacttcac cgtttgggta tccaagcgtt tgaacctgtg      1320
     cttatcgaag gtaaagcgat tcatttgcat ccattagtat gtgcggccta caacgccgat      1380
     ttcgatggtg accaaatggc ggtacacgta ccgctaacaa ttgaagcgca gcttgaagct      1440
     cgtgccttaa tgatgtctac aaacaacatt ctatctcctg cgaatggtga gccaatcatc      1500
     gttccttcac aggatgttgt attgggtctt tattacatga ctcgtgaccg tattaacgct      1560
     aaaggcgaag gcgcgatatt taaagatcca aaagaagcag aaaaagcata ccgtagtggc      1620
     aatgcagacc ttcacgcaat tgtgaaagta cgtattagtc aatcagttaa aaacgaaaac      1680
     ggcgtagtag aagatactat cactgttatt gatacaactg ttggtcgtgc aattctgtcg      1740
     ctaattttac caaaaggcat gccgtatgag tcaatcaatc agccgctagg taaaaagcag      1800
     atttctggct taattaatga gtgttaccgt cgtcttggtc ttaaagacac cgttatgttt      1860
     gctgaccaaa ttatgtacac cggtttccat tatgcaatga agtcaggtgt ttcaatcggt      1920
     attgatgact tagttatccc accggttaaa gcgcagatca ttgaatcagc tgaagctgaa      1980
     gttactgaaa tcaaccaaca attccaatca ggtcttgtaa cggctggtga aaagtacaat      2040
     aaagttatcg atatttggtc acgtgtaaat gaaaacttat cacgtgagat gatgtctaac      2100
     ttgtcgaaag acacagttat taatgcacaa ggtgaagaag tagagcaagc gtcatttaac      2160
     tcagtgttta tgatggccga ctcaggtgct cgtggtagtg ctgctcagat ccgtcagttg      2220
     gcgggtatgc gtggtctaat ggcacgtcca gatggttcaa tcatcgagac gccaatcaca      2280
     gctaacttcc gtgaaggtct aaacgtactt cagtacttca tctcaacgca tggtgcgcgt      2340
     aaaggtcttg ccgatacagc acttaaaaca gctaactcgg gttacctaac gcgtcgtcta      2400
     gtagacgttg cacaagattt ggtaatcaat gaagacgact gtggcacaga agatggctta      2460
     acaatgaaac cgcttattga aggtggtgat gttgtagaag cgcttcgtga acgtgtacta      2520
     ggtcgtgttg ttgctgaaga tattgttatt cctggtacta atacagtact agttgagcgt      2580
     aacattatgc ttgacgaaaa actgtgtgac cttttagaag agcactcagt agatgaagtt      2640
     cgcgtacgtt ctgttatcac gtgtgataat gactttggtg tttgtgctaa ctgttacggt      2700
     cgtgacctag cacgtggcca tatcatcaac gcaggtgaat cagtaggtgt tatcgcggca      2760
     caatcaattg gtgagccagg tacacagtta acgatgcgta cattccacat cggtggtgcg      2820
     gcatctagag cgtctgctga gaataatgta caagttaaaa ctaacggtac attaaagctt      2880
     cacaacgcta agtacgtatt aaatacagac ggtaagattg ctattatttc gcgttctacg      2940
     gaaattacta tcattgatag ttatggccgt gaaaaagagc gctataaagt accttacggt      3000
     gcagtattaa cagtacaaga caatgcagaa gttcaaggta acgacatcgt tgctacttgg      3060
     gacccgcata gtcacccaat cgtacttgag cataagtcaa aagtatcgtt cagcgatatc      3120
     gatgactcga atactgaaac acagacagat gaactaaccg gtttaacccg tatagttgtt      3180
     aaagatcttt ctaaagcgaa tgcgaaagaa cctaagctta tcattgaaag tgaagagcgc      3240
     ggcttacaag aaacacgtct accttcattc actacgattg aagtagttga cggcacgaca      3300
     gtaaaccctg gtgacgtatt agcacgtatt ccgcaagaag gttcgaaaac tcgtgatatc      3360
     acgggtggtc taccacgcgt agccgattta ttcgaagctc gtaaaccgaa agaaccagct      3420
     attttagctg aagttaccgg tacaattagc tttggtaaag agactaaagg taagaagcgt      3480
     ttagttatta caccagatga aggtgatcat tacgaagaga tgatccctaa atggcgtcaa      3540
     cttaacgtgt ttgaaggtga acgagtgtct aaaggtgaag ttatcgccga tggtccagaa      3600
     tcaccgcatg acatcttacg cttacgtggt gtgactcatg ttgctaacta cattgttaac      3660
     gaagtgcaag aggtttaccg tttgcaaggc gttaagatca atgacaagca cattgaaact      3720
     attattcgtc aaatgttacg taaatgtacc attatgcacg gtggtgatac tgacttctta      3780
     gccggtgagc aaattgaagt ggcacgcgtt aatatcgcaa accgcgacct tgaagctcaa      3840
     ggtaagatcc cagctaagtt tgaaatccag ttaatgggta tcacaaaagc atcactagca      3900
     acagaatctt tcatctctgc agcctctttc caagagacaa cacgtgtttt aaccgacgca      3960
     gcagtgaatg gtaagagcga tgagttacgc ggtctgaaag aaaacgtaat agtgggtcgt      4020
     ttgatcccag ccggtaccgg cttttcgtat catcaagaac gtatggctcg ccgtaagcaa      4080
     agaaatgtag tagaagagca gactgtaagt gcagaagagg caactcaagc gctaactgat      4140
     gctttaaatg cggatttatc tggaaatcaa taa                                   4173
//

If you have problems or comments...

PBIL Back to PBIL home page