(data stored in ACNUC7421 zone)

EMBL: CR954246.RPOH

CR954246.RPOH        Location/Qualifiers
FT   CDS_pept        371499..372362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="PSHAa0357"
FT                   /product="RNA polymerase sigma-32 factor (Heat shock
FT                   regulatory protein F33.4)"
FT                   /function="3.2.1.2.1 : Sigma factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2841288, 6387714; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85455"
FT                   /db_xref="GOA:Q3IIB1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB1"
FT                   /protein_id="CAI85455.1"
FT                   /translation="MSKDLYAMALTVGQQSASMDGYLQAVSTIPMLKVEQEQELATRLQ
FT                   EEGDLSAAKQLIMSHLRFVAHIAKGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRL
FT                   VSFAVHWIKAEIHEFVLKNWRIVKVATTKAQRKLFFNLRKNKKRLGWFNQAEVSTVASE
FT                   LGVSEKEVREMESRMSGQDMGFDLTGDDDDSAPSSTYSPVQYLTDGTADLADDIEQQQW
FT                   QEQSHTRLFSALKTLDERSQDIVSARWLTDDKATLQELAEKYSVSAERVRQLEKTAMKK
FT                   LQAAMV"
     atgagtaaag atttatacgc aatggcactt acagttggac agcaaagcgc aagcatggac        60
     ggttaccttc aagcggtaag cactattcct atgcttaaag tagagcaaga acaagagctg       120
     gcaacacgtc ttcaggaaga aggtgatctt agtgctgcaa agcaactcat tatgtcgcac       180
     ttacgctttg tagcgcatat tgcaaaaggc tactcgggtt atggcttgcc acaagcagat       240
     ttaatccaag aaggtaatat tggcctgatg aaagcggtaa agcgtttcaa cccagaagtg       300
     ggtgtgcgtt tagtatcgtt tgcagtgcat tggattaaag cagaaattca tgagtttgta       360
     cttaaaaact ggcgcatcgt aaaagttgct accactaaag cacaacgtaa attgtttttt       420
     aaccttcgta aaaataaaaa acgtttaggc tggtttaacc aagcagaagt tagcacagta       480
     gctagcgagc taggtgtgag tgaaaaagaa gtacgtgaaa tggaatcgcg catgagcggc       540
     caagacatgg gctttgacct tacaggtgat gacgacgaca gcgcaccaag cagcacctat       600
     tcaccagtac agtatttaac tgatggcact gctgatttag ctgatgatat tgagcagcaa       660
     caatggcaag aacaatcaca tactcgtttg tttagcgccc ttaaaacgct agatgaacgc       720
     tcgcaagaca ttgtaagcgc acgttggtta accgacgata aagcaacgct acaagaactt       780
     gctgaaaaat acagtgtatc ggctgagcgt gttcgccagc tagaaaaaac agcgatgaaa       840
     aagctacaag ctgcaatggt gtaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page