(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSC

CR954246.RPSC        Location/Qualifiers
FT   CDS_pept        159634..160335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="PSHAa0150"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2459390, 2657655, 6380588; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85254"
FT                   /db_xref="GOA:Q3IF19"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF19"
FT                   /protein_id="CAI85254.1"
FT                   /translation="MGQKVHPTGIRLGISKPWVSTWYASSKDFSAQLFGDHKVRTFLTK
FT                   ELKTASVSKIVIERPAKSIRVTIHTARPGVVIGKKGEDVEKLRQAVTKIAGVPAQINIS
FT                   EVRKPELDAQLVADGIASQLERRVMFRRAMKRSVQNAMRIGSKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATSEALTTYGIIGVKVWIFKGEVIGGLPLVQEQEKPAK
FT                   RAPKKAKKSAK"
     atgggacaaa aagttcatcc tactggtatt cgcctaggta tatctaaacc ttgggtttct        60
     acctggtacg cgagttcaaa agatttctct gcacagcttt ttggcgatca caaagtacgt       120
     acattcctta caaaggaatt gaaaacggct tctgtgtcta aaatcgttat tgagcgtcca       180
     gcaaaatcaa tccgcgtaac aatccacacg gctcgtccgg gtgttgttat cggtaaaaaa       240
     ggcgaagacg tagaaaaatt acgtcaagcg gtaactaaaa tcgctggtgt acctgctcag       300
     attaatattt ctgaagtacg taaaccagaa ctagatgcac aactagtagc agacggcatt       360
     gcctctcaac tagaacgtcg tgttatgttc cgtcgcgcta tgaagcgttc ggtacaaaat       420
     gcaatgcgca tcggttctaa agggattaaa gttgaagtta gcggtcgtct tggcggcgca       480
     gaaatcgcac gtacagagtg gtatcgtgaa ggtcgtgtac ctctacatac tcttcgtgct       540
     gatatcgact acgcaacttc tgaggcctta accacttatg gtatcattgg tgttaaagtt       600
     tggatcttca aaggcgaagt tattggtggt ttaccactag tacaagagca agagaagcca       660
     gctaaacgcg caccaaagaa agccaaaaaa agtgctaagt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page