(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSG

CR954246.RPSG        Location/Qualifiers
FT   CDS_pept        237306..237776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PSHAa0225"
FT                   /product="30S ribosomal subunit protein S7"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 385062, 7556101; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85328"
FT                   /db_xref="GOA:Q3ILP6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP6"
FT                   /protein_id="CAI85328.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNIVMLDGKKSTAEKIVYG
FT                   ALNVAAEKSGKSHLEIFETALDNIRPQVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWL
FT                   VDAARKRGEKSMGLRLAQEIVDAADNKGTAVKKREDVHRMAEANKAFAHYRW"
     atgcctagaa gacgcgtaat aggtcaacgt aaaattcttc cagatcctaa gttcggatcg        60
     gagcttcttg cgaaattcgt aaacatcgta atgttagatg gcaagaaatc tactgctgaa       120
     aaaatcgttt atggtgcgct aaatgtggct gctgagaaat caggcaagtc gcacctagaa       180
     atctttgaaa cggcacttga taatatccgc ccacaggtag aagttaaatc tcgccgtgtt       240
     ggtggttcaa cttaccaagt accagttgaa gtacgtccag ttcgtcgtaa cgcattaggt       300
     atgcgttggt tagtagacgc tgctcgtaag cgtggcgaaa aatctatggg cttacgttta       360
     gctcaagaaa tcgttgacgc tgctgacaac aaaggcactg cggttaagaa acgtgaagac       420
     gttcaccgta tggctgaagc gaataaagca ttcgctcatt accgttggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page