(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSJ

CR954246.RPSJ        Location/Qualifiers
FT   CDS_pept        156245..156556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="PSHAa0143"
FT                   /product="30S ribosomal subunit protein S10 (NusE protein)"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10383769, 10498727; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85247"
FT                   /db_xref="GOA:Q3IF26"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF26"
FT                   /protein_id="CAI85247.1"
FT                   /translation="MSNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   FERFTVLTSPHVNKDARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG"
     atgtcaaatc aacgcattcg tattcgccta aaagcttttg accaccgttt gattgaccaa        60
     tcaacggcgg aaatcgtgga aactgcgaaa cgcactggcg cacaagtacg tggaccaatt       120
     ccactaccta cacgctttga acgttttact gtactaacat caccgcacgt taataaagac       180
     gcgcgtgatc agtacgagat ccgcacccat aaacgtctga tcgacatcgt tgaaccaact       240
     gacaagactg ttgacgctct tatgcgttta gatcttgctg ctggtgtaga tgttcaaatc       300
     agcctgggtt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page