(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSL

CR954246.RPSL        Location/Qualifiers
FT   CDS_pept        236833..237207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PSHAa0224"
FT                   /product="30S ribosomal protein S12"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 320034, 7556101, 8844851; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85327"
FT                   /db_xref="GOA:Q3ILP7"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP7"
FT                   /protein_id="CAI85327.1"
FT                   /translation="MATINQLVRKPRRSKVTKSNSAALKACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRFHTVRGALDC
FT                   AGVSDRRQARSKYGTKRPKG"
     atggcaacta ttaaccagct agtgcgtaag ccacgccgta gcaaggttac gaaaagtaac        60
     tcagctgcgc ttaaagcgtg tccgcaaaag cgcggtgtat gtactcgcgt atatacaact       120
     acacctaaga aaccaaactc ggcgttacgt aaagtagctc gtgtacgttt aactaacggt       180
     ttcgaagtaa cttcatacat tggtggtgaa ggtcataacc ttcaagagca tagtgtaatc       240
     ctaatccgtg gtggtcgtgt taaagattta ccaggtgtgc gttttcacac cgttcgtggt       300
     gcacttgact gtgcaggcgt tagcgatcgt cgccaagctc gttctaaata cggtactaaa       360
     cgccctaaag gctaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page