(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSQ

CR954246.RPSQ        Location/Qualifiers
FT   CDS_pept        160952..161209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="PSHAa0153"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11985624, 12051911, 14654705; Product type s : structural
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85257"
FT                   /db_xref="GOA:Q3IFM3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM3"
FT                   /protein_id="CAI85257.1"
FT                   /translation="MSDKIRTLQGRVISDKMEKSFTIAIARYVKHPIYGKFIRRTTKLH
FT                   VHDENNEVQAGDVVTIRECAPISKSKSWTFVAVIERPKQA"
     atgagcgata aaattcgtac tcttcaaggc cgtgtaatta gcgacaagat ggaaaaatct        60
     ttcactattg ctatcgcacg ttatgtgaag cacccaattt atgggaaatt cattcgacgc       120
     acgactaagc tacacgtaca tgacgaaaat aatgaagttc aggctggtga cgtagttact       180
     atccgtgaat gtgctccaat ttctaagagt aaatcttgga cattcgtagc agttattgaa       240
     cgtccaaaac aagcttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page