(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSS

CR954246.RPSS        Location/Qualifiers
FT   CDS_pept        158985..159275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="PSHAa0148"
FT                   /product="30S ribosomal protein S19"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 348496, 3279034, 12244297; Product type s :
FT                   structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85252"
FT                   /db_xref="GOA:Q3IF21"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF21"
FT                   /protein_id="CAI85252.1"
FT                   /translation="MRNSHATFSQEGSFYRPTLLKKVEKALESGDKKPIKTWSRRSMII
FT                   PNMIGLTIAVHNGRQHVPVFITDEMIGHKLGEFAPTRTYRGHAADKKAKKR"
     ttgaggaata gccatgccac gttctctcaa gaagggtcct tttatagacc tacactgctg        60
     aagaaggtag agaaagcgtt ggaaagcgga gacaagaagc caattaaaac ttggagccgt       120
     cgttcaatga tcatacctaa catgatcgga ttgaccatcg ctgtccataa tggtcgtcag       180
     cacgttcctg tgtttatcac agacgaaatg atcggtcaca aactaggtga atttgcacca       240
     actcgcactt accgtggcca tgctgcggat aagaaagcga agaaacgata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page