(data stored in ACNUC7421 zone)

EMBL: CR954246.RPSU

CR954246.RPSU        Location/Qualifiers
FT   CDS_pept        complement(366251..366466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="PSHAa0352"
FT                   /product="30S ribosomal subunit protein S21"
FT                   /function="3.3.1 : Ribosomal proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6186393; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85450"
FT                   /db_xref="GOA:Q3IIB6"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIB6"
FT                   /protein_id="CAI85450.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTAER
FT                   KRKKAAAVKRHMKKLSRDNARRVKLY"
     atgccagtaa ttaaagtaag agagaacgaa ccgtttgacg tagcacttcg tcgcttcaag        60
     cgttcatgtg aaaaagcagg aatcctttca gaagttcgtc gtcgcgagca ctatgaaaaa       120
     ccaacagctg agcgtaagcg taaaaaagct gctgcagtaa aacgtcacat gaaaaaactt       180
     tctcgtgata acgcacgtcg cgttaaatta tactaa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page