(data stored in ACNUC7421 zone)

EMBL: CR954246.RSMB

CR954246.RSMB        Location/Qualifiers
FT   CDS_pept        complement(24095..25390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="PSHAa0021"
FT                   /product="16S rRNA m5C967 methyltransferase,
FT                   S-adenosyl-L-methionine-dependent"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10026269; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85135"
FT                   /db_xref="GOA:Q3IDH1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH1"
FT                   /protein_id="CAI85135.1"
FT                   /translation="MSNVPNVRALAAETLYNVVDKGASLNQELPFASQGLPPKDKALLQ
FT                   QICYGVLRYLPSLENYCQHLVEEPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN
FT                   ALQQLRALGLKGLINAILRSFQRQQLELEEKAKLIPVCLYNHPNWFIKQVKEAYPDSWE
FT                   DLLAENQQQAPMWLRVNQAQYSTQEYSDMLTANDIEHTLNPDFIDGIKLAKPRDVFSLP
FT                   EFDTGACSVQDAAAQLAARFLEPKDDDTILDACAAPGGKTCHILELADAEVLALDSDAT
FT                   RLERVKQNLTRIGLGADLQCGDASQPHTWWDEKQFDRILLDVPCSATGVIRRHPDIKWL
FT                   RRASDIADLAALQGDILDSIWPLLKPGGTLVYATCSVLPQENQQQVAKFLANNNDVEHI
FT                   PLHDKDTPTTPGLQLLPGESDGFYYAKLVKKI"
     atgagtaatg ttccaaacgt acgagcgctt gccgctgaaa ctttatataa cgtagttgat        60
     aaaggcgctt cgcttaatca agaactacca tttgccagcc aaggcttgcc acctaaagat       120
     aaagccctgc tacagcaaat ttgctatggc gttttacgct atttaccaag ccttgaaaac       180
     tactgccaac atttagttga ggagccgtta aaaggtaagc gtagaatatt tcagttttta       240
     ttgtatgtgg gcatttacca actacaacac atgcgtgttc cgccacatgc ggcaatttca       300
     gaaactgtaa atgcactaca acaattgcgt gctttgggtt taaaaggact tattaacgct       360
     attctacgta gttttcagcg ccaacaactt gagcttgaag aaaaagccaa acttattccg       420
     gtgtgtttat acaatcatcc aaactggttt atcaaacaag ttaaagaagc ttatcctgat       480
     agttgggaag atctgcttgc agaaaaccaa cagcaagcgc ctatgtggct gcgtgtaaat       540
     caagcgcaat acagcacgca agaatacagc gatatgctaa cagctaacga tattgagcat       600
     acacttaacc ctgattttat agatgggata aagttagcta aaccacgaga tgtattttca       660
     ttacccgagt ttgataccgg tgcttgttct gtacaagatg ctgctgcaca gttagctgcg       720
     cgctttttag agcctaaaga tgacgacact attttagatg cctgcgccgc gccgggtggc       780
     aaaacctgtc atattttaga attggccgat gctgaggtac ttgcccttga tagcgatgca       840
     actcgcctag agcgtgttaa gcaaaactta actcgtatag gcttaggtgc cgacctacaa       900
     tgtggtgatg catcacaacc acacacttgg tgggatgaaa aacagtttga tcgtatttta       960
     ctcgacgtac cttgctcggc taccggtgtt attcgccgcc accccgatat aaagtggttg      1020
     cgtcgtgcat cagacattgc cgatttagca gcattacaag gcgatatact cgatagtatt      1080
     tggccgcttc taaagccagg tggcaccttg gtatacgcta cttgttcagt actccctcaa      1140
     gaaaaccaac aacaagttgc taagttttta gctaataaca atgatgttga gcatattcct      1200
     ctacatgata aagacacgcc caccacacct ggtttacagt tacttcctgg tgaaagcgat      1260
     ggcttttatt acgctaaact agttaaaaaa atataa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page