(data stored in ACNUC7421 zone)

EMBL: CR954246.RSMC

CR954246.RSMC        Location/Qualifiers
FT   CDS_pept        complement(567820..568845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="PSHAa0552"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="2.1.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9873033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85640"
FT                   /db_xref="GOA:Q3ILJ2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ2"
FT                   /protein_id="CAI85640.1"
FT                   /translation="MSVLTNPSLLLLRNSEKLVGKSILVVNFVQDGFLAELKKRNPESK
FT                   ITAFSYNHANGEFAKNTPGVDVCVNHCISGNDFDLVILYYPKSKPEVLMALDNIRAVIT
FT                   ADAELLVVGENKSGVKSIEKQLTDKANFSNKIDSAKHCVLYSFAELKQLSQFNISDYHK
FT                   PFTVSVADSEFTAISIPGVFNHGNLDVGTKILLENAPLIKQGTVLDFGCGAGLIATYLG
FT                   LQNPALSFVCSDVSALAIYATTQTLKLNNIKGEALLSDGLTNITGKFDLIISNPPFHTG
FT                   IATDYTVAETFLANAKQHLTKAGKLNIVANSFLKYPPILEAQFDNYQTVFKNNKFAVYS
FT                   S"
     atgagcgtat taaccaatcc aagcctactg ttacttcgca atagcgaaaa gttagttggg        60
     aaatctatat tggtggtcaa ctttgttcaa gatggctttt tagccgagct taaaaagcgc       120
     aaccctgaga gtaaaataac cgcctttagc tacaatcatg ctaatggcga atttgccaaa       180
     aacacacccg gcgttgatgt atgtgtaaac cactgtatta gcggtaacga ctttgattta       240
     gtgattcttt actatccaaa atcaaaacct gaagttctta tggcgcttga taatatacgc       300
     gcagtaatta cagcagatgc tgagttactg gtggttggcg aaaataagag tggtgttaaa       360
     tcaatagaaa aacagcttac tgataaagct aattttagta ataaaataga ctcagcaaag       420
     cactgtgttt tatattcatt tgcagagctt aaacaactta gtcagtttaa tattagcgat       480
     tatcataagc catttacggt cagtgtggcc gatagcgaat ttaccgctat cagtattcct       540
     ggggtattta atcacggtaa tttagatgtt ggcactaaaa tattgcttga aaacgctccg       600
     cttattaagc aaggtactgt gctcgatttt ggttgtggcg ctggcttaat tgcaacttat       660
     ttagggctgc aaaatccggc attgagcttt gtttgtagtg atgtgagcgc tttggcaatc       720
     tatgcaacaa cgcaaaccct taagcttaat aacattaaag gcgaagccct cttaagtgat       780
     ggacttacta acattacagg taagttcgat cttattatta gtaacccacc ttttcatacc       840
     ggtattgcaa ccgactacac agtggctgaa acctttttag ccaatgctaa acagcaccta       900
     actaaagcag gtaagttaaa tattgttgct aatagctttt taaaataccc gccaatttta       960
     gaagcacaat ttgataacta tcaaaccgtg tttaaaaata ataagtttgc cgtttacagc      1020
     agttaa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page