(data stored in ACNUC7421 zone)

EMBL: CR954246.RSUA

CR954246.RSUA        Location/Qualifiers
FT   CDS_pept        complement(486414..487112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="PSHAa0467"
FT                   /product="16S rRNA pseudouridylate 516 synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7612632; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85564"
FT                   /db_xref="GOA:Q3IFQ2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFQ2"
FT                   /protein_id="CAI85564.1"
FT                   /translation="MKFPCRLDKFISHLAELPRSKARASIKRQAALVNGEVVTAFDFQI
FT                   KQQDEVVFQGEQLVFLGKRYFMLNKPVGYVSANSDELHKTVFDLIDEPNMSDFHVAGRL
FT                   DIDTTGLVILTNDGDWSHKITSPKNNKFKTYLVETQEPITDESLDALREGVQLHNEKAL
FT                   TRPAKAERLANYGLRLSICEGKYHQVKRMLAAVDNKVVELHREQIGNIKLDENLAAGEY
FT                   RLLTAEEIKL"
     atgaaattcc cttgccgcct agataaattt attagccatt tagcagagct gccacgctca        60
     aaagccagag ccagcattaa acgccaagcc gcactagtca atggtgaagt ggtcactgct       120
     ttcgattttc aaattaagca gcaagacgaa gtagtttttc aaggtgaaca actcgtattt       180
     ttaggtaaac gctacttcat gttaaacaaa cccgttggtt atgtaagtgc caatagtgat       240
     gagctacaca aaacggtatt cgatttaatt gacgagccaa atatgagcga ctttcacgta       300
     gcaggccgcc tcgatattga caccactggc ttagttatct taaccaacga tggcgactgg       360
     tcgcataaaa taacgtctcc taaaaacaat aaatttaaaa cctatttagt agaaacccaa       420
     gagcccatta ctgacgaatc gttagatgca ctgcgcgaag gggtacaatt acataacgaa       480
     aaagctctaa cccgtccggc aaaagcagag cgcctcgcta attacggctt acgtttatct       540
     atttgtgaag gtaaatacca ccaagttaag cgcatgttag ccgctgtaga caataaagtg       600
     gttgaattgc accgcgaaca aattggcaat attaaactag acgaaaacct agcagcgggt       660
     gaatatcgct tgttaacagc cgaagaaatt aaactgtaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page