(data stored in ACNUC7421 zone)

EMBL: CR954246.SDAC

CR954246.SDAC        Location/Qualifiers
FT   CDS_pept        complement(211123..212382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaC"
FT                   /locus_tag="PSHAa0200"
FT                   /product="putative serine transport protein (HAAAP family)"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8026499; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85303"
FT                   /db_xref="GOA:Q3IFT3"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT3"
FT                   /protein_id="CAI85303.1"
FT                   /translation="MPPSQDATHFNASTAKQSSWTLHDTQWTLSLFGTAVGAGILFLPI
FT                   NIGIGGFWPLIIMACLAFPMTFLAHRGLARFVLSSKNKDADFTDVVEEHFGVTAGRLIS
FT                   LLYFLSIFPILLIYGVGLTNTVDSFMVNQLGMESPSRVLLSGVLVAGMIGLMMGGEKLM
FT                   LRAFAILVYPLVGILFFLSLYLIPSWQMPNMALPEVGSFGKTLWLSIPIIVFSFSHAAA
FT                   ISSFVNVQRGHYGNKAVAKSEAILKRTSLLLITFVLLFVFSCVLSLTGEQMAAAKAANV
FT                   SVLSYLANITDNSFIATLGPLVAFIAIMSSFLGHFLGARESFTGLVTKQSNISAKVADK
FT                   VGAVLMFFAIWFCAVKNPSILDMMDQLSGPIIAMILFIMPMIAVYKVPALHKHRNRLST
FT                   LFILAVGSMAVMALLYSMLK"
     atgcccccat ctcaagatgc tacgcatttt aatgcatcta cagcaaaaca gtcttcttgg        60
     actttacacg acacacagtg gacgttaagc ctatttggta ccgccgttgg tgccggtatt       120
     ttatttttac ctattaatat tggtattggc ggtttttggc cgttaattat tatggcgtgc       180
     ttagcctttc caatgacctt tttagcgcac cgcggtttag cgcggtttgt gctgtcgtca       240
     aaaaataaag atgctgactt taccgatgta gtagaggagc attttggggt gaccgcgggt       300
     cggctaatct ctttgctgta ctttttatct atttttccga ttttacttat ttatggtgtc       360
     ggtttaacca ataccgtaga cagctttatg gtgaaccagc ttggtatgga gtcgccttcg       420
     cgggtgttgc tttctggtgt attggttgca ggtatgattg gcttaatgat gggcggcgaa       480
     aagctgatgc ttcgtgcttt tgctatttta gtttatccgc ttgtgggcat attgtttttt       540
     ttatccttgt atttaatccc tagttggcaa atgccgaata tggcgctgcc agaagtgggc       600
     agctttggta aaacactgtg gttgtcgatt cctattattg tattttcgtt tagccacgca       660
     gcggctattt cgagctttgt aaacgtacaa cgcggtcatt atggtaataa agcggttgct       720
     aagtctgagg cgatattaaa gcgcaccagt ttactgttaa ttacctttgt attgctgttt       780
     gtgttttcgt gtgtgttgtc cttaactggc gagcaaatgg cggcggcgaa agcggcaaat       840
     gtgtcggttt tatcgtacct tgccaatatt actgacaatt cgtttattgc tacgcttggc       900
     ccattggtgg cgtttattgc gattatgtcg tcatttttag ggcacttttt gggtgcacgc       960
     gaaagcttta ctggcttagt aactaagcag tcgaacataa gcgctaaagt tgccgataag      1020
     gtaggtgctg tactaatgtt ttttgctatt tggttttgcg cggttaaaaa cccgagcata      1080
     ctcgatatga tggatcagtt atctggccct attattgcga tgattttatt tattatgccc      1140
     atgattgctg tttataaagt accggcatta cacaagcatc gtaatcgttt aagcacctta      1200
     tttatattag cggttggctc aatggcggta atggctttgc tttacagcat gcttaaataa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page