(data stored in ACNUC7421 zone)

EMBL: CR954246.SECB

CR954246.SECB        Location/Qualifiers
FT   CDS_pept        385351..385839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="PSHAa0369"
FT                   /product="molecular chaperone in protein export, enhances
FT                   activity of SecA (General Secretory Pathway)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12427258, 14517549, 15010547; Product type mc : molecular
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85467"
FT                   /db_xref="GOA:Q3IIE1"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIE1"
FT                   /protein_id="CAI85467.1"
FT                   /translation="MNEETQNAAAQQETGAQFTIQRIYTKDVSFETPNSPAIFQKEWTP
FT                   EVKLDLDTRSNKLDEGVFEVVLALTVTASIGEETAFLCEIQQAGIFTIADVEETQLAHM
FT                   LGAFCPNVLFPYAREAVSNLVNRGTFPQLNLAPVNFDALFAQYMQQRTAQAEQASVDA"
     atgaacgaag aaacgcaaaa cgcagcagca caacaagaaa ctggcgcaca atttactatt        60
     caacgtattt acacaaaaga cgtgtcgttt gaaacgccaa attctccagc tatttttcaa       120
     aaagaatgga caccagaagt taagttagac ctagacactc gctctaataa gttagacgaa       180
     ggtgtatttg aagtggtttt agcactaaca gtgactgcat ctattggcga agaaacggcc       240
     tttttatgtg aaattcaaca agcaggtatt tttactattg ctgacgttga agaaacacaa       300
     cttgctcata tgcttggagc attttgccct aacgtattgt ttccatatgc gcgtgaagca       360
     gtttctaacc ttgttaaccg cggtactttt ccacagctta accttgcgcc agttaacttt       420
     gacgcattat ttgcacaata catgcaacaa cgcacagcgc aagctgagca ggcatcagta       480
     gacgcataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page